Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167TIL2

Protein Details
Accession A0A167TIL2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
47-70IHYATLKPEQKKKKEKKGGAAAAGHydrophilic
NLS Segment(s)
PositionSequence
55-79EQKKKKEKKGGAAAAGGRGRDNARK
Subcellular Location(s) cyto 11.5, cyto_nucl 7, mito 6, extr 4, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPNFDFLRSVGATKEAVAVLNDQPNLFTNLIVVLIGLGVQGGLLWYIHYATLKPEQKKKKEKKGGAAAAGGRGRDNARK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.12
3 0.11
4 0.11
5 0.13
6 0.13
7 0.16
8 0.16
9 0.14
10 0.15
11 0.15
12 0.18
13 0.16
14 0.13
15 0.1
16 0.09
17 0.09
18 0.09
19 0.07
20 0.03
21 0.03
22 0.03
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.03
34 0.04
35 0.04
36 0.04
37 0.07
38 0.16
39 0.23
40 0.29
41 0.38
42 0.47
43 0.57
44 0.68
45 0.76
46 0.79
47 0.83
48 0.85
49 0.87
50 0.88
51 0.85
52 0.77
53 0.72
54 0.62
55 0.57
56 0.51
57 0.41
58 0.31
59 0.26