Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162LH18

Protein Details
Accession A0A162LH18    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
70-89IAKKREWKVREKLRRSARKVBasic
119-138SDSRDEKGYPKRDKGKKSQEBasic
NLS Segment(s)
PositionSequence
72-92KKREWKVREKLRRSARKVAAA
128-135PKRDKGKK
Subcellular Location(s) cyto 9.5, cyto_nucl 9.5, nucl 8.5, plas 4, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSTTSAHFPLPTNEFTDAGEGPVDSGTEAGAAGDSSKNSINLSTGGMIAIIIVVVVVVIVGVSTATLFFIAKKREWKVREKLRRSARKVAAALTPRRSQFPDSVKRSVEAPKSSRLQTSDSRDEKGYPKRDKGKKSQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.26
4 0.2
5 0.17
6 0.15
7 0.11
8 0.1
9 0.09
10 0.09
11 0.06
12 0.05
13 0.05
14 0.04
15 0.04
16 0.04
17 0.03
18 0.03
19 0.04
20 0.05
21 0.06
22 0.07
23 0.08
24 0.09
25 0.09
26 0.1
27 0.1
28 0.1
29 0.11
30 0.1
31 0.09
32 0.08
33 0.07
34 0.07
35 0.05
36 0.04
37 0.03
38 0.02
39 0.02
40 0.01
41 0.01
42 0.01
43 0.01
44 0.01
45 0.01
46 0.01
47 0.01
48 0.01
49 0.01
50 0.02
51 0.02
52 0.02
53 0.02
54 0.03
55 0.04
56 0.08
57 0.1
58 0.12
59 0.18
60 0.22
61 0.29
62 0.33
63 0.41
64 0.47
65 0.56
66 0.65
67 0.66
68 0.72
69 0.75
70 0.81
71 0.79
72 0.79
73 0.73
74 0.7
75 0.64
76 0.57
77 0.53
78 0.5
79 0.48
80 0.43
81 0.42
82 0.36
83 0.38
84 0.38
85 0.35
86 0.36
87 0.4
88 0.45
89 0.46
90 0.5
91 0.49
92 0.47
93 0.47
94 0.47
95 0.44
96 0.41
97 0.38
98 0.41
99 0.44
100 0.45
101 0.47
102 0.42
103 0.4
104 0.41
105 0.46
106 0.49
107 0.48
108 0.49
109 0.47
110 0.48
111 0.51
112 0.53
113 0.54
114 0.53
115 0.6
116 0.67
117 0.74
118 0.8