Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167PAM3

Protein Details
Accession A0A167PAM3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
70-89TLTARRRVAKRANRNLRANCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001469  ATP_synth_F1_dsu/esu  
IPR020546  ATP_synth_F1_dsu/esu_N  
IPR036771  ATPsynth_dsu/esu_N  
Gene Ontology GO:0045261  C:proton-transporting ATP synthase complex, catalytic core F(1)  
GO:0046933  F:proton-transporting ATP synthase activity, rotational mechanism  
Pfam View protein in Pfam  
PF02823  ATP-synt_DE_N  
CDD cd12152  F1-ATPase_delta  
Amino Acid Sequences MNSLRIARAAVRARPVAMRMAAQRRGYAEAIPDKVRSSPEIPLLLIHPWLTRETDQAEPVSASPGTNFPTLTARRRVAKRANRNLRANCARRNFFLPAGQARSAAPDRCENLRQHRANYLNQTIFKSQNVVQVNIPAESGEMGVLANHVPSIEQLKPGVVEVVEESGSTKSFFLSGGFATVQPDSALSINAPEAYPLEDFSAEAIRNQIAEAQKIASGNGSEQDIAEAKIELEVLETLQAHVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.33
4 0.29
5 0.29
6 0.31
7 0.37
8 0.42
9 0.41
10 0.42
11 0.39
12 0.42
13 0.39
14 0.32
15 0.3
16 0.3
17 0.32
18 0.32
19 0.31
20 0.28
21 0.29
22 0.3
23 0.27
24 0.24
25 0.24
26 0.27
27 0.27
28 0.26
29 0.25
30 0.25
31 0.22
32 0.2
33 0.17
34 0.13
35 0.12
36 0.13
37 0.16
38 0.15
39 0.16
40 0.19
41 0.21
42 0.22
43 0.21
44 0.21
45 0.18
46 0.17
47 0.17
48 0.14
49 0.11
50 0.1
51 0.11
52 0.13
53 0.13
54 0.13
55 0.12
56 0.19
57 0.22
58 0.27
59 0.31
60 0.32
61 0.39
62 0.43
63 0.5
64 0.53
65 0.6
66 0.66
67 0.7
68 0.77
69 0.78
70 0.83
71 0.78
72 0.78
73 0.77
74 0.71
75 0.68
76 0.65
77 0.59
78 0.52
79 0.53
80 0.46
81 0.38
82 0.36
83 0.31
84 0.27
85 0.29
86 0.27
87 0.23
88 0.2
89 0.23
90 0.23
91 0.2
92 0.18
93 0.17
94 0.19
95 0.22
96 0.26
97 0.25
98 0.31
99 0.4
100 0.4
101 0.39
102 0.43
103 0.43
104 0.43
105 0.45
106 0.41
107 0.34
108 0.33
109 0.34
110 0.3
111 0.27
112 0.24
113 0.21
114 0.18
115 0.22
116 0.22
117 0.21
118 0.19
119 0.21
120 0.22
121 0.19
122 0.17
123 0.11
124 0.09
125 0.08
126 0.08
127 0.04
128 0.03
129 0.03
130 0.03
131 0.04
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.04
138 0.08
139 0.08
140 0.09
141 0.1
142 0.1
143 0.1
144 0.11
145 0.11
146 0.07
147 0.06
148 0.06
149 0.07
150 0.07
151 0.06
152 0.07
153 0.07
154 0.08
155 0.08
156 0.08
157 0.06
158 0.07
159 0.07
160 0.07
161 0.08
162 0.07
163 0.09
164 0.09
165 0.09
166 0.11
167 0.1
168 0.1
169 0.08
170 0.09
171 0.08
172 0.08
173 0.08
174 0.06
175 0.07
176 0.07
177 0.08
178 0.08
179 0.07
180 0.07
181 0.09
182 0.09
183 0.09
184 0.1
185 0.09
186 0.1
187 0.1
188 0.14
189 0.12
190 0.12
191 0.13
192 0.12
193 0.12
194 0.12
195 0.15
196 0.14
197 0.15
198 0.16
199 0.15
200 0.17
201 0.17
202 0.17
203 0.14
204 0.13
205 0.12
206 0.13
207 0.13
208 0.12
209 0.12
210 0.14
211 0.13
212 0.13
213 0.13
214 0.11
215 0.1
216 0.1
217 0.1
218 0.08
219 0.08
220 0.08
221 0.07
222 0.09
223 0.09