Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162I769

Protein Details
Accession A0A162I769    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MASLRKPRRSPSRWRKSRNPAATAPHydrophilic
NLS Segment(s)
PositionSequence
5-20RKPRRSPSRWRKSRNP
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MASLRKPRRSPSRWRKSRNPAATAPRGDERALAFSTRTTKPPFLVVAVSRGTSAQVLVRVSEVQLQLQRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.88
4 0.91
5 0.88
6 0.83
7 0.79
8 0.77
9 0.75
10 0.66
11 0.59
12 0.5
13 0.43
14 0.37
15 0.31
16 0.23
17 0.19
18 0.17
19 0.14
20 0.12
21 0.12
22 0.16
23 0.16
24 0.18
25 0.19
26 0.2
27 0.2
28 0.22
29 0.22
30 0.18
31 0.2
32 0.18
33 0.18
34 0.17
35 0.17
36 0.14
37 0.14
38 0.13
39 0.1
40 0.1
41 0.09
42 0.11
43 0.11
44 0.11
45 0.13
46 0.12
47 0.13
48 0.18
49 0.16
50 0.18