Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167UGE3

Protein Details
Accession A0A167UGE3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
53-77HSSVKKRCEHCKVVRRKAGKRHNGYBasic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MASIFRTLALSSRAFLPRAPTSVLAGGVVSPFSKVLALGATTTQQQIRGMKVHSSVKKRCEHCKVVRRKAGKRHNGYLYIICKANPRHKQRQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.26
4 0.25
5 0.27
6 0.28
7 0.24
8 0.23
9 0.24
10 0.23
11 0.17
12 0.14
13 0.11
14 0.09
15 0.08
16 0.06
17 0.05
18 0.05
19 0.05
20 0.05
21 0.04
22 0.04
23 0.05
24 0.05
25 0.05
26 0.06
27 0.06
28 0.07
29 0.08
30 0.08
31 0.08
32 0.1
33 0.1
34 0.12
35 0.13
36 0.14
37 0.14
38 0.18
39 0.25
40 0.29
41 0.36
42 0.4
43 0.45
44 0.52
45 0.55
46 0.6
47 0.61
48 0.64
49 0.66
50 0.71
51 0.74
52 0.77
53 0.81
54 0.81
55 0.8
56 0.82
57 0.82
58 0.83
59 0.8
60 0.78
61 0.77
62 0.72
63 0.67
64 0.63
65 0.56
66 0.49
67 0.42
68 0.35
69 0.35
70 0.38
71 0.45
72 0.48
73 0.54