Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167Q529

Protein Details
Accession A0A167Q529    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
52-77SPTRDGSSKKEKKQHKHDQLQSAVKMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MYSAELVYVAPYLMSAEKRREVNRINSAASSRKNSLADASAATSAAPSRAASPTRDGSSKKEKKQHKHDQLQSAVKMSMNSRLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.2
4 0.25
5 0.3
6 0.32
7 0.38
8 0.42
9 0.47
10 0.51
11 0.5
12 0.47
13 0.43
14 0.44
15 0.42
16 0.39
17 0.35
18 0.28
19 0.28
20 0.27
21 0.26
22 0.25
23 0.21
24 0.19
25 0.14
26 0.13
27 0.1
28 0.09
29 0.09
30 0.07
31 0.06
32 0.05
33 0.05
34 0.04
35 0.06
36 0.09
37 0.11
38 0.12
39 0.16
40 0.19
41 0.21
42 0.25
43 0.25
44 0.29
45 0.39
46 0.46
47 0.5
48 0.56
49 0.63
50 0.7
51 0.79
52 0.84
53 0.84
54 0.86
55 0.87
56 0.87
57 0.86
58 0.83
59 0.74
60 0.66
61 0.56
62 0.46
63 0.4
64 0.32