Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167WLI8

Protein Details
Accession A0A167WLI8   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
62-91IELLRNSRDKRARKLAKKRRKVDELQRVIAHydrophilic
NLS Segment(s)
PositionSequence
68-82SRDKRARKLAKKRRK
Subcellular Location(s) mito 22, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAKEATAKTGLAVGLNKGHKTTARVVKPRVSRTKGHLSKRTAFVREVVKEVAGLAPYERRVIELLRNSRDKRARKLAKKRRKVDELQRVIADSRRTAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.22
4 0.21
5 0.22
6 0.22
7 0.25
8 0.32
9 0.35
10 0.41
11 0.48
12 0.51
13 0.57
14 0.62
15 0.67
16 0.68
17 0.63
18 0.58
19 0.58
20 0.65
21 0.66
22 0.67
23 0.65
24 0.62
25 0.63
26 0.66
27 0.64
28 0.55
29 0.48
30 0.43
31 0.41
32 0.36
33 0.32
34 0.25
35 0.2
36 0.18
37 0.17
38 0.14
39 0.08
40 0.07
41 0.05
42 0.07
43 0.07
44 0.09
45 0.08
46 0.08
47 0.09
48 0.1
49 0.16
50 0.22
51 0.28
52 0.32
53 0.4
54 0.4
55 0.48
56 0.55
57 0.56
58 0.57
59 0.62
60 0.67
61 0.71
62 0.81
63 0.83
64 0.86
65 0.91
66 0.91
67 0.9
68 0.88
69 0.87
70 0.87
71 0.87
72 0.84
73 0.78
74 0.7
75 0.62
76 0.55
77 0.51
78 0.43