Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168D777

Protein Details
Accession A0A168D777   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
227-255QGGRVSGRVVKRKRDRKRGKASGPMVKREBasic
NLS Segment(s)
PositionSequence
180-190GRRRRRRSGRG
232-254SGRVVKRKRDRKRGKASGPMVKR
Subcellular Location(s) nucl 18, cyto_nucl 12.833, mito_nucl 9.833, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MAMKMEIVEISSDEEDVQIPPPPSQSHFAKFEDFTPDDAAPFEDEFARLAASQEWVPGSQEYKKERTIAMRAEIKSHFFSQEPLAPITEEDELRGYQSLCEEVDLPPYDTTEECKRELKKTLVNIVDLIDTRRTNRKVKVWQDFQAFREYTLQDGHTISREEASKDGGYLESLLQHLGGGRRRRRRSGRGVGNLERGNVSAGIVKREQLPEGGNASAIVGKSQQSPQGGRVSGRVVKRKRDRKRGKASGPMVKREQRLDGGETSEHMVKRERPSEAGGRLQTLVKIEQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.12
5 0.14
6 0.15
7 0.15
8 0.19
9 0.21
10 0.23
11 0.29
12 0.33
13 0.34
14 0.38
15 0.4
16 0.41
17 0.4
18 0.39
19 0.41
20 0.36
21 0.32
22 0.31
23 0.28
24 0.24
25 0.24
26 0.22
27 0.16
28 0.15
29 0.14
30 0.11
31 0.11
32 0.11
33 0.11
34 0.1
35 0.08
36 0.09
37 0.09
38 0.1
39 0.1
40 0.11
41 0.12
42 0.11
43 0.13
44 0.13
45 0.15
46 0.18
47 0.25
48 0.28
49 0.32
50 0.34
51 0.35
52 0.37
53 0.4
54 0.41
55 0.39
56 0.41
57 0.44
58 0.41
59 0.43
60 0.42
61 0.39
62 0.36
63 0.33
64 0.28
65 0.21
66 0.22
67 0.21
68 0.25
69 0.24
70 0.21
71 0.2
72 0.19
73 0.18
74 0.18
75 0.17
76 0.12
77 0.1
78 0.11
79 0.1
80 0.11
81 0.12
82 0.1
83 0.08
84 0.09
85 0.1
86 0.08
87 0.09
88 0.09
89 0.08
90 0.12
91 0.13
92 0.14
93 0.13
94 0.13
95 0.14
96 0.13
97 0.16
98 0.19
99 0.2
100 0.21
101 0.26
102 0.28
103 0.32
104 0.37
105 0.38
106 0.36
107 0.38
108 0.43
109 0.39
110 0.37
111 0.34
112 0.29
113 0.25
114 0.2
115 0.17
116 0.13
117 0.12
118 0.13
119 0.2
120 0.24
121 0.27
122 0.32
123 0.38
124 0.45
125 0.53
126 0.6
127 0.57
128 0.59
129 0.6
130 0.58
131 0.51
132 0.48
133 0.4
134 0.32
135 0.3
136 0.25
137 0.2
138 0.18
139 0.17
140 0.12
141 0.13
142 0.12
143 0.11
144 0.11
145 0.1
146 0.11
147 0.12
148 0.11
149 0.11
150 0.13
151 0.12
152 0.11
153 0.11
154 0.09
155 0.08
156 0.08
157 0.08
158 0.06
159 0.06
160 0.06
161 0.06
162 0.05
163 0.07
164 0.1
165 0.15
166 0.23
167 0.31
168 0.41
169 0.46
170 0.55
171 0.63
172 0.68
173 0.73
174 0.76
175 0.78
176 0.77
177 0.8
178 0.74
179 0.73
180 0.64
181 0.54
182 0.44
183 0.34
184 0.25
185 0.18
186 0.14
187 0.12
188 0.12
189 0.14
190 0.14
191 0.15
192 0.17
193 0.18
194 0.18
195 0.16
196 0.17
197 0.16
198 0.18
199 0.17
200 0.14
201 0.13
202 0.13
203 0.12
204 0.11
205 0.09
206 0.07
207 0.09
208 0.11
209 0.13
210 0.17
211 0.19
212 0.21
213 0.24
214 0.3
215 0.3
216 0.28
217 0.28
218 0.3
219 0.32
220 0.37
221 0.43
222 0.42
223 0.51
224 0.61
225 0.7
226 0.75
227 0.81
228 0.86
229 0.87
230 0.93
231 0.93
232 0.91
233 0.91
234 0.88
235 0.87
236 0.82
237 0.79
238 0.75
239 0.72
240 0.67
241 0.6
242 0.56
243 0.51
244 0.48
245 0.45
246 0.39
247 0.36
248 0.32
249 0.29
250 0.28
251 0.28
252 0.25
253 0.23
254 0.26
255 0.29
256 0.37
257 0.42
258 0.41
259 0.4
260 0.45
261 0.51
262 0.51
263 0.53
264 0.46
265 0.43
266 0.41
267 0.4
268 0.36
269 0.31