Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168CM28

Protein Details
Accession A0A168CM28   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
16-37HSFTWQKKYRHLHSRRDEQRTAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 9, mito 6, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR024222  Ten1_fungal  
Gene Ontology GO:1990879  C:CST complex  
GO:0043047  F:single-stranded telomeric DNA binding  
GO:0016233  P:telomere capping  
Pfam View protein in Pfam  
PF12658  Ten1  
Amino Acid Sequences MEGQIGVLDWLFIHVHSFTWQKKYRHLHSRRDEQRTAALGTLPAVLAAASQGGRQGAEPSTDQPVHSVTAYSTSTACITLGHLYPRGTDVSVTVNVELLLETLAGEATRTGEWVNVIGYVKGGSGSAATATATVQAVMVWPAGPMDIQQYEAALEEDYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.12
4 0.19
5 0.21
6 0.3
7 0.39
8 0.4
9 0.49
10 0.58
11 0.64
12 0.69
13 0.74
14 0.75
15 0.77
16 0.85
17 0.85
18 0.84
19 0.76
20 0.68
21 0.65
22 0.57
23 0.49
24 0.38
25 0.29
26 0.21
27 0.2
28 0.17
29 0.11
30 0.08
31 0.06
32 0.05
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.05
39 0.05
40 0.06
41 0.06
42 0.08
43 0.08
44 0.09
45 0.1
46 0.11
47 0.15
48 0.16
49 0.15
50 0.14
51 0.15
52 0.14
53 0.13
54 0.12
55 0.07
56 0.1
57 0.11
58 0.1
59 0.09
60 0.09
61 0.09
62 0.09
63 0.09
64 0.05
65 0.06
66 0.07
67 0.08
68 0.09
69 0.1
70 0.1
71 0.1
72 0.11
73 0.11
74 0.1
75 0.09
76 0.08
77 0.09
78 0.1
79 0.11
80 0.09
81 0.09
82 0.09
83 0.09
84 0.08
85 0.05
86 0.04
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.04
95 0.05
96 0.05
97 0.05
98 0.06
99 0.06
100 0.07
101 0.07
102 0.08
103 0.08
104 0.08
105 0.08
106 0.08
107 0.07
108 0.07
109 0.07
110 0.05
111 0.04
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.06
119 0.06
120 0.06
121 0.06
122 0.05
123 0.06
124 0.07
125 0.07
126 0.05
127 0.05
128 0.05
129 0.06
130 0.06
131 0.06
132 0.1
133 0.1
134 0.12
135 0.12
136 0.12
137 0.12
138 0.13
139 0.14