Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168EPT1

Protein Details
Accession A0A168EPT1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
96-115NKDHNKNDNKDHNKNDNKNDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 20, E.R. 3, cyto 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038843  Sed1/Spi1  
Gene Ontology GO:0005199  F:structural constituent of cell wall  
GO:0031505  P:fungal-type cell wall organization  
Amino Acid Sequences MKLSLFTLALVVGAHAAATGPLSEPPGKNVTYGNDHGHDYGNDYDKNYDKDHKDHDKDHDKDHNKDHDKDHDKDHDKDYNKDHDKDYNKDHNKNDNKDHNKNDNKDHNKNDNKNDNKNDNKNDNKNNNINNNINNNVNNNTNTNTNTNTNTNTNTNTNTNTNTNNNTNTNTNTNVNNNTNNNNNTNINNNNNVNNNNNVNNNNNKNNNNNKNNNNNKNNNTNLHTFTTVVEKFTTFCPGPTLIPIRSDKTITVTKATLLVVTECPCTIVTTVATQPPATNLPPAPPAVSPAPPAVSPAPPAASPPPAAKPAPPAANPAAPVASPAAPAAPGAPAASPAAPGSPGSPGTPGTAGTPASPAKPGAPGTVTAGAGRLGASLGALVVAAAVALAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.04
5 0.04
6 0.05
7 0.05
8 0.07
9 0.11
10 0.16
11 0.17
12 0.21
13 0.25
14 0.25
15 0.26
16 0.27
17 0.29
18 0.31
19 0.34
20 0.35
21 0.33
22 0.34
23 0.34
24 0.34
25 0.29
26 0.26
27 0.27
28 0.27
29 0.26
30 0.26
31 0.29
32 0.31
33 0.34
34 0.35
35 0.38
36 0.38
37 0.43
38 0.51
39 0.57
40 0.59
41 0.62
42 0.68
43 0.7
44 0.68
45 0.7
46 0.71
47 0.68
48 0.67
49 0.7
50 0.71
51 0.67
52 0.69
53 0.67
54 0.67
55 0.68
56 0.64
57 0.63
58 0.63
59 0.62
60 0.61
61 0.62
62 0.6
63 0.56
64 0.59
65 0.58
66 0.58
67 0.59
68 0.58
69 0.54
70 0.54
71 0.57
72 0.57
73 0.59
74 0.6
75 0.61
76 0.65
77 0.68
78 0.7
79 0.74
80 0.75
81 0.75
82 0.75
83 0.76
84 0.77
85 0.79
86 0.79
87 0.79
88 0.76
89 0.76
90 0.76
91 0.76
92 0.76
93 0.76
94 0.76
95 0.77
96 0.8
97 0.8
98 0.8
99 0.78
100 0.79
101 0.78
102 0.77
103 0.76
104 0.77
105 0.75
106 0.75
107 0.76
108 0.76
109 0.78
110 0.75
111 0.74
112 0.72
113 0.71
114 0.68
115 0.64
116 0.59
117 0.54
118 0.51
119 0.45
120 0.4
121 0.35
122 0.31
123 0.27
124 0.26
125 0.23
126 0.2
127 0.19
128 0.19
129 0.2
130 0.2
131 0.2
132 0.2
133 0.22
134 0.22
135 0.23
136 0.23
137 0.24
138 0.24
139 0.24
140 0.24
141 0.24
142 0.24
143 0.24
144 0.24
145 0.24
146 0.24
147 0.24
148 0.25
149 0.27
150 0.27
151 0.28
152 0.28
153 0.27
154 0.26
155 0.26
156 0.25
157 0.23
158 0.23
159 0.21
160 0.22
161 0.25
162 0.25
163 0.27
164 0.27
165 0.26
166 0.29
167 0.29
168 0.28
169 0.26
170 0.26
171 0.22
172 0.24
173 0.25
174 0.23
175 0.24
176 0.24
177 0.24
178 0.25
179 0.26
180 0.23
181 0.23
182 0.22
183 0.2
184 0.21
185 0.2
186 0.21
187 0.26
188 0.29
189 0.32
190 0.35
191 0.35
192 0.4
193 0.49
194 0.55
195 0.57
196 0.6
197 0.61
198 0.66
199 0.74
200 0.76
201 0.74
202 0.72
203 0.67
204 0.66
205 0.64
206 0.57
207 0.51
208 0.45
209 0.4
210 0.34
211 0.31
212 0.25
213 0.22
214 0.25
215 0.21
216 0.19
217 0.16
218 0.14
219 0.14
220 0.14
221 0.19
222 0.12
223 0.12
224 0.14
225 0.14
226 0.15
227 0.17
228 0.21
229 0.17
230 0.21
231 0.23
232 0.23
233 0.23
234 0.24
235 0.21
236 0.22
237 0.25
238 0.22
239 0.23
240 0.2
241 0.19
242 0.21
243 0.2
244 0.16
245 0.12
246 0.12
247 0.12
248 0.13
249 0.13
250 0.11
251 0.11
252 0.11
253 0.11
254 0.1
255 0.09
256 0.09
257 0.11
258 0.13
259 0.14
260 0.15
261 0.14
262 0.14
263 0.15
264 0.17
265 0.15
266 0.17
267 0.15
268 0.16
269 0.18
270 0.19
271 0.18
272 0.16
273 0.19
274 0.18
275 0.19
276 0.18
277 0.18
278 0.18
279 0.17
280 0.2
281 0.18
282 0.16
283 0.17
284 0.17
285 0.17
286 0.15
287 0.18
288 0.18
289 0.18
290 0.19
291 0.2
292 0.22
293 0.25
294 0.25
295 0.24
296 0.28
297 0.32
298 0.35
299 0.33
300 0.35
301 0.35
302 0.36
303 0.36
304 0.31
305 0.25
306 0.2
307 0.2
308 0.17
309 0.14
310 0.12
311 0.11
312 0.1
313 0.09
314 0.09
315 0.09
316 0.07
317 0.07
318 0.07
319 0.07
320 0.07
321 0.09
322 0.09
323 0.09
324 0.09
325 0.09
326 0.09
327 0.1
328 0.09
329 0.11
330 0.12
331 0.12
332 0.14
333 0.14
334 0.16
335 0.16
336 0.15
337 0.14
338 0.16
339 0.15
340 0.15
341 0.18
342 0.17
343 0.18
344 0.19
345 0.18
346 0.17
347 0.21
348 0.22
349 0.21
350 0.21
351 0.21
352 0.24
353 0.27
354 0.26
355 0.22
356 0.21
357 0.18
358 0.16
359 0.15
360 0.1
361 0.06
362 0.06
363 0.06
364 0.05
365 0.04
366 0.04
367 0.04
368 0.03
369 0.03
370 0.03
371 0.02