Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167LIS8

Protein Details
Accession A0A167LIS8   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
148-173GDDKDKTGAKKLKKKAKVIKLSFDEDBasic
NLS Segment(s)
PositionSequence
37-48AAARRRPAGKKR
114-123IGGRKRKVGK
144-165KSDKGDDKDKTGAKKLKKKAKV
Subcellular Location(s) cyto 12.5, cyto_nucl 10.5, nucl 7.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MPEKFNAKNLSYASKPPPFLAALQAQAAGHKGPDPIAAARRRPAGKKRSSSEEAEDVPLVVDEHGNALALEVDKDGVVAAGQHDADPTRGDGGDAGEKEKGNKDGGAANAKMTIGGRKRKVGKIVGEEAEDGKENGKENGNGLKSDKGDDKDKTGAKKLKKKAKVIKLSFDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.45
3 0.4
4 0.4
5 0.35
6 0.33
7 0.32
8 0.27
9 0.23
10 0.22
11 0.22
12 0.19
13 0.18
14 0.18
15 0.13
16 0.1
17 0.1
18 0.09
19 0.09
20 0.1
21 0.12
22 0.14
23 0.22
24 0.26
25 0.28
26 0.31
27 0.37
28 0.4
29 0.45
30 0.51
31 0.54
32 0.59
33 0.64
34 0.66
35 0.67
36 0.67
37 0.64
38 0.59
39 0.54
40 0.45
41 0.39
42 0.33
43 0.25
44 0.2
45 0.17
46 0.12
47 0.07
48 0.06
49 0.04
50 0.05
51 0.05
52 0.05
53 0.04
54 0.04
55 0.05
56 0.05
57 0.05
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.03
64 0.03
65 0.03
66 0.03
67 0.04
68 0.04
69 0.04
70 0.05
71 0.05
72 0.06
73 0.06
74 0.06
75 0.06
76 0.05
77 0.05
78 0.06
79 0.07
80 0.09
81 0.09
82 0.1
83 0.11
84 0.11
85 0.12
86 0.14
87 0.15
88 0.13
89 0.13
90 0.13
91 0.14
92 0.17
93 0.2
94 0.18
95 0.16
96 0.16
97 0.16
98 0.15
99 0.12
100 0.16
101 0.18
102 0.25
103 0.28
104 0.34
105 0.4
106 0.44
107 0.5
108 0.5
109 0.5
110 0.49
111 0.52
112 0.47
113 0.42
114 0.38
115 0.33
116 0.28
117 0.23
118 0.16
119 0.12
120 0.11
121 0.12
122 0.13
123 0.16
124 0.15
125 0.17
126 0.24
127 0.24
128 0.24
129 0.25
130 0.28
131 0.26
132 0.29
133 0.32
134 0.29
135 0.34
136 0.34
137 0.37
138 0.41
139 0.45
140 0.46
141 0.51
142 0.54
143 0.58
144 0.66
145 0.71
146 0.74
147 0.78
148 0.83
149 0.84
150 0.87
151 0.88
152 0.85
153 0.85