Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167V6Y4

Protein Details
Accession A0A167V6Y4    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MDIDMSRRNKRPRPLSNEERSRLDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12, cyto 3.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000789  Cyclin-dep_kinase_reg-sub  
IPR036858  Cyclin-dep_kinase_reg-sub_sf  
Gene Ontology GO:0016538  F:cyclin-dependent protein serine/threonine kinase regulator activity  
GO:0016301  F:kinase activity  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF01111  CKS  
PROSITE View protein in PROSITE  
PS00945  CKS_2  
Amino Acid Sequences MDIDMSRRNKRPRPLSNEERSRLDEFVESIHYSNRYNDSEYEYRHVQLPKAMLKAIPEDYQDSSKGTLKLLWEEEWRALGITQSLGWEHYEVHEPEPHILLFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.85
4 0.87
5 0.81
6 0.75
7 0.69
8 0.62
9 0.52
10 0.43
11 0.34
12 0.24
13 0.21
14 0.2
15 0.15
16 0.13
17 0.15
18 0.15
19 0.15
20 0.17
21 0.21
22 0.19
23 0.2
24 0.21
25 0.25
26 0.27
27 0.28
28 0.3
29 0.26
30 0.25
31 0.28
32 0.27
33 0.21
34 0.2
35 0.22
36 0.2
37 0.2
38 0.2
39 0.16
40 0.16
41 0.18
42 0.18
43 0.15
44 0.13
45 0.14
46 0.15
47 0.17
48 0.16
49 0.15
50 0.15
51 0.17
52 0.17
53 0.15
54 0.15
55 0.15
56 0.18
57 0.19
58 0.19
59 0.18
60 0.19
61 0.19
62 0.19
63 0.18
64 0.15
65 0.12
66 0.11
67 0.09
68 0.08
69 0.08
70 0.08
71 0.08
72 0.08
73 0.09
74 0.09
75 0.09
76 0.1
77 0.17
78 0.17
79 0.2
80 0.23
81 0.23
82 0.25
83 0.27