Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2WU63

Protein Details
Accession G2WU63    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
182-212LDKVKKSKKLRAGKGKMRGRRFRQRRGPLVVBasic
311-337KGGPTTRRSAVQKKNPLRNKQVMLRLNHydrophilic
NLS Segment(s)
PositionSequence
184-208KVKKSKKLRAGKGKMRGRRFRQRRG
Subcellular Location(s) mito 10, cyto 6.5, extr 6, cyto_nucl 4, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR025755  Ribos_L4_C_dom  
IPR002136  Ribosomal_L4/L1e  
IPR013000  Ribosomal_L4/L1e_euk/arc_CS  
IPR023574  Ribosomal_L4_dom_sf  
IPR045240  Ribosomal_L4_euk/arch  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG vda:VDAG_01336  -  
Pfam View protein in Pfam  
PF14374  Ribos_L4_asso_C  
PF00573  Ribosomal_L4  
PROSITE View protein in PROSITE  
PS00939  RIBOSOMAL_L1E  
Amino Acid Sequences MASRPTVTIIGGDGKATGNTHTWPVVFSSPIRTDIVQDVHKGLAKNKRQPYAVSEKAGEQTSAESWGTGRAVARIPRVSGGGTHRAGQAAFGNMCRSGRMFAPTKVWRKWHVKVNLGQKRYAVASALAASAVAPLLLARGHRISNVVEVPLVIDSDAFKSAAFAKTSAAAGLLKSVGAGPDLDKVKKSKKLRAGKGKMRGRRFRQRRGPLVVYDPEVDGKELISGFRNIAGVETSAVTDLNLLQLAPGGHLGRFIVWTSAAFKALDTIYGTTTTPSELKKDFLLPSNIISQSDLSRLINSQETQSAIREAKGGPTTRRSAVQKKNPLRNKQVMLRLNPYAAVFAKEAAQKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.15
5 0.13
6 0.14
7 0.17
8 0.18
9 0.17
10 0.17
11 0.2
12 0.2
13 0.2
14 0.2
15 0.25
16 0.25
17 0.28
18 0.29
19 0.26
20 0.27
21 0.3
22 0.34
23 0.29
24 0.29
25 0.28
26 0.28
27 0.31
28 0.29
29 0.31
30 0.35
31 0.42
32 0.49
33 0.55
34 0.59
35 0.59
36 0.59
37 0.61
38 0.61
39 0.58
40 0.52
41 0.46
42 0.42
43 0.43
44 0.41
45 0.33
46 0.24
47 0.19
48 0.16
49 0.18
50 0.15
51 0.12
52 0.11
53 0.13
54 0.13
55 0.12
56 0.12
57 0.11
58 0.16
59 0.19
60 0.24
61 0.23
62 0.24
63 0.24
64 0.25
65 0.23
66 0.22
67 0.24
68 0.26
69 0.25
70 0.26
71 0.25
72 0.25
73 0.25
74 0.22
75 0.19
76 0.15
77 0.15
78 0.14
79 0.15
80 0.15
81 0.15
82 0.15
83 0.14
84 0.11
85 0.12
86 0.17
87 0.19
88 0.2
89 0.29
90 0.36
91 0.43
92 0.45
93 0.48
94 0.51
95 0.55
96 0.6
97 0.6
98 0.6
99 0.59
100 0.62
101 0.69
102 0.69
103 0.63
104 0.57
105 0.48
106 0.43
107 0.37
108 0.3
109 0.2
110 0.12
111 0.11
112 0.1
113 0.1
114 0.08
115 0.07
116 0.06
117 0.05
118 0.05
119 0.03
120 0.02
121 0.02
122 0.03
123 0.03
124 0.04
125 0.05
126 0.07
127 0.08
128 0.08
129 0.1
130 0.1
131 0.13
132 0.14
133 0.12
134 0.1
135 0.1
136 0.1
137 0.09
138 0.08
139 0.05
140 0.04
141 0.04
142 0.05
143 0.06
144 0.06
145 0.05
146 0.06
147 0.08
148 0.11
149 0.11
150 0.1
151 0.1
152 0.11
153 0.11
154 0.1
155 0.09
156 0.07
157 0.06
158 0.06
159 0.06
160 0.04
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.09
168 0.11
169 0.11
170 0.13
171 0.16
172 0.21
173 0.29
174 0.34
175 0.37
176 0.45
177 0.55
178 0.63
179 0.71
180 0.75
181 0.75
182 0.81
183 0.81
184 0.79
185 0.78
186 0.78
187 0.75
188 0.77
189 0.78
190 0.78
191 0.81
192 0.82
193 0.8
194 0.79
195 0.74
196 0.65
197 0.61
198 0.52
199 0.43
200 0.35
201 0.28
202 0.21
203 0.18
204 0.16
205 0.1
206 0.09
207 0.08
208 0.07
209 0.07
210 0.08
211 0.08
212 0.08
213 0.09
214 0.09
215 0.08
216 0.08
217 0.08
218 0.07
219 0.07
220 0.07
221 0.06
222 0.06
223 0.06
224 0.05
225 0.05
226 0.05
227 0.05
228 0.05
229 0.04
230 0.04
231 0.06
232 0.06
233 0.06
234 0.08
235 0.08
236 0.08
237 0.08
238 0.08
239 0.07
240 0.08
241 0.08
242 0.07
243 0.07
244 0.08
245 0.1
246 0.11
247 0.12
248 0.11
249 0.11
250 0.12
251 0.12
252 0.13
253 0.11
254 0.11
255 0.11
256 0.12
257 0.12
258 0.11
259 0.11
260 0.12
261 0.13
262 0.13
263 0.17
264 0.17
265 0.18
266 0.2
267 0.24
268 0.25
269 0.28
270 0.31
271 0.28
272 0.29
273 0.33
274 0.32
275 0.28
276 0.26
277 0.22
278 0.19
279 0.2
280 0.19
281 0.14
282 0.15
283 0.15
284 0.17
285 0.2
286 0.19
287 0.2
288 0.2
289 0.21
290 0.21
291 0.22
292 0.25
293 0.21
294 0.21
295 0.21
296 0.19
297 0.23
298 0.28
299 0.31
300 0.31
301 0.37
302 0.41
303 0.41
304 0.48
305 0.5
306 0.54
307 0.6
308 0.66
309 0.7
310 0.76
311 0.84
312 0.86
313 0.88
314 0.87
315 0.86
316 0.83
317 0.81
318 0.81
319 0.78
320 0.75
321 0.71
322 0.65
323 0.56
324 0.5
325 0.42
326 0.35
327 0.29
328 0.25
329 0.19
330 0.17
331 0.21
332 0.25