Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2XJ43

Protein Details
Accession G2XJ43    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
38-60QSSGSKKQKDVKHTPRKQPTPAEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, mito_nucl 11.666, nucl 9, cyto_nucl 7.666, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009445  TMEM85/Emc4  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
KEGG vda:VDAG_10175  -  
Pfam View protein in Pfam  
PF06417  DUF1077  
Amino Acid Sequences MSLVKGDTPRWVSQLHSPPASKQKVNGISDPNGYPSSQSSGSKKQKDVKHTPRKQPTPAEMDTLKVKKAWEVALAPAKNLPMTAIMMYMSGNSLQIFSIMMVLMAFKTPITGLFAVNSAFERFESDTNKGQMFQVKMAYLAMQVLALAVGVWKVNAMGLLPTTRSDWLGWETVREPLENAIAAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.43
3 0.43
4 0.43
5 0.47
6 0.56
7 0.59
8 0.51
9 0.45
10 0.49
11 0.52
12 0.54
13 0.53
14 0.49
15 0.46
16 0.48
17 0.45
18 0.39
19 0.31
20 0.27
21 0.23
22 0.19
23 0.21
24 0.2
25 0.23
26 0.25
27 0.35
28 0.44
29 0.5
30 0.54
31 0.57
32 0.6
33 0.67
34 0.72
35 0.73
36 0.75
37 0.78
38 0.83
39 0.85
40 0.86
41 0.83
42 0.79
43 0.74
44 0.69
45 0.61
46 0.55
47 0.45
48 0.4
49 0.4
50 0.34
51 0.29
52 0.23
53 0.21
54 0.18
55 0.2
56 0.19
57 0.15
58 0.15
59 0.18
60 0.24
61 0.24
62 0.23
63 0.21
64 0.2
65 0.17
66 0.16
67 0.12
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.05
76 0.05
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.04
97 0.07
98 0.07
99 0.07
100 0.08
101 0.09
102 0.09
103 0.09
104 0.1
105 0.07
106 0.07
107 0.07
108 0.09
109 0.1
110 0.13
111 0.16
112 0.19
113 0.23
114 0.25
115 0.25
116 0.23
117 0.23
118 0.26
119 0.24
120 0.22
121 0.2
122 0.18
123 0.18
124 0.17
125 0.16
126 0.11
127 0.1
128 0.08
129 0.05
130 0.05
131 0.04
132 0.04
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.04
142 0.04
143 0.04
144 0.05
145 0.07
146 0.08
147 0.09
148 0.1
149 0.12
150 0.13
151 0.14
152 0.14
153 0.15
154 0.17
155 0.21
156 0.2
157 0.22
158 0.22
159 0.26
160 0.27
161 0.24
162 0.22
163 0.19
164 0.22