Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2X282

Protein Details
Accession G2X282    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
139-161PTSTTAGKGKKNKKQNEEDSEAEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR015418  Eaf6  
Gene Ontology GO:0035267  C:NuA4 histone acetyltransferase complex  
GO:0005634  C:nucleus  
GO:0006325  P:chromatin organization  
GO:0006281  P:DNA repair  
GO:0016573  P:histone acetylation  
KEGG vda:VDAG_04406  -  
Pfam View protein in Pfam  
PF09340  NuA4  
Amino Acid Sequences MAENVAPTTGIAGATPSLQMYKQEQVKLKAMLEQRNQVARRLAAIESDIETKEAAYLDSTPHGNIIAGFDNYIKGTSGAGAQRRKQGNTEQHRVFSRSSISYRPGMQEVTTPGSVGSTPASHAPTPMSTSFKDKDGATPTSTTAGKGKKNKKQNEEDSEAESHAPNKKRINFGAARK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.08
5 0.09
6 0.12
7 0.15
8 0.22
9 0.27
10 0.33
11 0.39
12 0.42
13 0.47
14 0.47
15 0.44
16 0.42
17 0.43
18 0.45
19 0.44
20 0.45
21 0.45
22 0.49
23 0.5
24 0.47
25 0.44
26 0.36
27 0.34
28 0.3
29 0.25
30 0.18
31 0.18
32 0.16
33 0.13
34 0.15
35 0.13
36 0.11
37 0.11
38 0.1
39 0.1
40 0.09
41 0.07
42 0.06
43 0.07
44 0.07
45 0.09
46 0.1
47 0.09
48 0.09
49 0.09
50 0.08
51 0.07
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.09
58 0.09
59 0.09
60 0.07
61 0.05
62 0.05
63 0.05
64 0.08
65 0.1
66 0.16
67 0.2
68 0.22
69 0.29
70 0.31
71 0.32
72 0.32
73 0.36
74 0.41
75 0.45
76 0.51
77 0.45
78 0.46
79 0.47
80 0.46
81 0.39
82 0.3
83 0.25
84 0.2
85 0.21
86 0.2
87 0.21
88 0.21
89 0.22
90 0.22
91 0.21
92 0.18
93 0.16
94 0.16
95 0.16
96 0.17
97 0.16
98 0.14
99 0.13
100 0.13
101 0.12
102 0.11
103 0.09
104 0.06
105 0.07
106 0.09
107 0.12
108 0.11
109 0.12
110 0.13
111 0.13
112 0.16
113 0.18
114 0.19
115 0.17
116 0.23
117 0.24
118 0.25
119 0.26
120 0.23
121 0.27
122 0.29
123 0.3
124 0.27
125 0.26
126 0.26
127 0.27
128 0.27
129 0.23
130 0.23
131 0.27
132 0.32
133 0.41
134 0.5
135 0.55
136 0.66
137 0.74
138 0.78
139 0.82
140 0.85
141 0.84
142 0.81
143 0.74
144 0.69
145 0.61
146 0.52
147 0.43
148 0.33
149 0.28
150 0.3
151 0.32
152 0.34
153 0.41
154 0.47
155 0.53
156 0.55
157 0.6