Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167VVR9

Protein Details
Accession A0A167VVR9   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
230-251TVPPLCKSAQEKRKKRVPRDQQHydrophilic
NLS Segment(s)
PositionSequence
242-245RKKR
Subcellular Location(s) nucl 14, mito 6, cyto 2, plas 2, E.R. 1, golg 1, vacu 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
Amino Acid Sequences MADSELRQRKAKGDDGQTKQSTKRRTTDEEDYDSSSLRLDILRVLTFLFVASCGLSYVISSGESFFWGMQNKPNYLKPEWWKAKFAGPIYLTPDELSQYNGYEKGKPLYLAVNGTIFDVSSGLHMYGIGGSYHFFVGRDASRAYVSGCFEEDLTPDMRGLEEMYLPIDDPEIDSKWTTAEMKQLKEQELAEAKERVHSGLKHWVDFFTNSPKYQKVGYVKREEGWLEKLTVPPLCKSAQEKRKKRVPRDQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.65
3 0.72
4 0.7
5 0.68
6 0.68
7 0.66
8 0.65
9 0.62
10 0.63
11 0.6
12 0.63
13 0.67
14 0.69
15 0.69
16 0.66
17 0.62
18 0.58
19 0.51
20 0.44
21 0.37
22 0.27
23 0.2
24 0.14
25 0.11
26 0.08
27 0.1
28 0.12
29 0.13
30 0.12
31 0.13
32 0.12
33 0.11
34 0.11
35 0.08
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.06
42 0.05
43 0.05
44 0.05
45 0.06
46 0.06
47 0.06
48 0.07
49 0.07
50 0.07
51 0.08
52 0.07
53 0.1
54 0.12
55 0.13
56 0.18
57 0.22
58 0.24
59 0.27
60 0.32
61 0.34
62 0.34
63 0.41
64 0.4
65 0.47
66 0.54
67 0.53
68 0.51
69 0.47
70 0.51
71 0.48
72 0.43
73 0.39
74 0.31
75 0.3
76 0.32
77 0.32
78 0.26
79 0.22
80 0.21
81 0.15
82 0.14
83 0.14
84 0.09
85 0.09
86 0.1
87 0.12
88 0.13
89 0.14
90 0.15
91 0.15
92 0.15
93 0.14
94 0.14
95 0.14
96 0.14
97 0.13
98 0.13
99 0.12
100 0.11
101 0.11
102 0.1
103 0.07
104 0.06
105 0.05
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.03
117 0.04
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.07
124 0.08
125 0.1
126 0.09
127 0.1
128 0.1
129 0.1
130 0.11
131 0.11
132 0.12
133 0.1
134 0.1
135 0.1
136 0.1
137 0.1
138 0.1
139 0.09
140 0.09
141 0.09
142 0.08
143 0.08
144 0.08
145 0.08
146 0.08
147 0.06
148 0.06
149 0.05
150 0.06
151 0.06
152 0.06
153 0.06
154 0.06
155 0.05
156 0.06
157 0.08
158 0.08
159 0.1
160 0.1
161 0.1
162 0.1
163 0.12
164 0.12
165 0.11
166 0.18
167 0.22
168 0.25
169 0.3
170 0.33
171 0.33
172 0.34
173 0.34
174 0.31
175 0.32
176 0.31
177 0.3
178 0.28
179 0.26
180 0.27
181 0.28
182 0.23
183 0.23
184 0.22
185 0.22
186 0.3
187 0.32
188 0.31
189 0.31
190 0.3
191 0.28
192 0.29
193 0.29
194 0.28
195 0.3
196 0.3
197 0.33
198 0.33
199 0.33
200 0.33
201 0.37
202 0.37
203 0.43
204 0.5
205 0.55
206 0.56
207 0.56
208 0.58
209 0.52
210 0.47
211 0.42
212 0.35
213 0.3
214 0.29
215 0.3
216 0.29
217 0.31
218 0.29
219 0.26
220 0.27
221 0.25
222 0.28
223 0.33
224 0.41
225 0.47
226 0.56
227 0.64
228 0.71
229 0.79
230 0.85
231 0.88