Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167R1S1

Protein Details
Accession A0A167R1S1    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-29PTSADPRSHRPTKRRALSPSHydrophilic
116-147REGRERRDEERTRRNRDKREKMRARKAGKGKTBasic
NLS Segment(s)
PositionSequence
116-154REGRERRDEERTRRNRDKREKMRARKAGKGKTGGSARGS
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSAEIPESIPTSADPRSHRPTKRRALSPSSAHAASVSALFAKPDRDIRLPGGGGRPTHAHSRPPEIVANVQGSSAGAGSGEFHVYKAARRREYERLRAMDEDVRREREQEAFERDREGRERRDEERTRRNRDKREKMRARKAGKGKTGGSARGSAGGGVKPTNVVAGREREEEDAEEGKNGTAGAAAAEPGLVIHDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.31
3 0.4
4 0.49
5 0.57
6 0.62
7 0.7
8 0.75
9 0.8
10 0.8
11 0.79
12 0.78
13 0.78
14 0.75
15 0.7
16 0.64
17 0.55
18 0.46
19 0.39
20 0.3
21 0.23
22 0.17
23 0.12
24 0.07
25 0.07
26 0.08
27 0.09
28 0.1
29 0.12
30 0.16
31 0.2
32 0.22
33 0.25
34 0.27
35 0.3
36 0.29
37 0.29
38 0.29
39 0.27
40 0.25
41 0.24
42 0.24
43 0.22
44 0.29
45 0.28
46 0.29
47 0.29
48 0.36
49 0.36
50 0.36
51 0.36
52 0.3
53 0.3
54 0.26
55 0.25
56 0.18
57 0.16
58 0.13
59 0.11
60 0.09
61 0.08
62 0.05
63 0.03
64 0.03
65 0.04
66 0.04
67 0.05
68 0.05
69 0.05
70 0.07
71 0.07
72 0.11
73 0.18
74 0.25
75 0.28
76 0.3
77 0.36
78 0.44
79 0.51
80 0.56
81 0.55
82 0.5
83 0.49
84 0.47
85 0.43
86 0.38
87 0.32
88 0.3
89 0.26
90 0.28
91 0.26
92 0.27
93 0.26
94 0.25
95 0.26
96 0.24
97 0.29
98 0.27
99 0.27
100 0.29
101 0.29
102 0.28
103 0.31
104 0.31
105 0.29
106 0.33
107 0.37
108 0.37
109 0.47
110 0.52
111 0.56
112 0.62
113 0.66
114 0.69
115 0.75
116 0.81
117 0.81
118 0.85
119 0.87
120 0.87
121 0.89
122 0.9
123 0.9
124 0.92
125 0.91
126 0.86
127 0.83
128 0.82
129 0.79
130 0.75
131 0.7
132 0.61
133 0.59
134 0.57
135 0.51
136 0.44
137 0.37
138 0.31
139 0.28
140 0.26
141 0.19
142 0.17
143 0.15
144 0.14
145 0.12
146 0.12
147 0.1
148 0.1
149 0.13
150 0.12
151 0.13
152 0.16
153 0.22
154 0.25
155 0.27
156 0.29
157 0.27
158 0.27
159 0.27
160 0.26
161 0.23
162 0.2
163 0.19
164 0.18
165 0.16
166 0.15
167 0.13
168 0.09
169 0.07
170 0.06
171 0.06
172 0.06
173 0.06
174 0.06
175 0.05
176 0.05
177 0.05
178 0.06