Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167MC13

Protein Details
Accession A0A167MC13    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
309-334FVRSKSSKLSWFRRRRPRPPSETLDLHydrophilic
NLS Segment(s)
PositionSequence
322-325RRRP
Subcellular Location(s) nucl 11.5, cyto_nucl 10.5, cyto 8.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
CDD cd00303  retropepsin_like  
Amino Acid Sequences MVWSPDGNRVCGIRTPEIRGTLGRIPVRALPDWGSAVNAVSEAFARRHNLEIDTTTSVCSIPLMGGNVAHSIGRVTGCFKFKGRGSSSHRCEFHVLRKSLHDVILGRAFLDETETLTLYSHRIVQVVRPCLRRGKRLFLLDNETPKAARIRCAVNGASASAFPDTGSDLMLVSGDFARRNGFKVHRGKKYRSRVELIDGSTILTDGMVLDAKLQFDVPPLPSLHEVDYDAYGSFLSGLSHLTGRGRRASSMMTFICDLHVVEDLPCDIILSHDFIFRNQVFSRFNSLFHSGRDETRQKDAASVDRCLMFVRSKSSKLSWFRRRRPRPPSETLDLPLRSSPSWDDLWELEVAQRNRMQLWIASLSEPQKSVEERNEAQRRALWDRENPRPPPTPAPSSDPSLRRIPVSRPSPAASQTGASSITAAVSAVSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.42
3 0.45
4 0.47
5 0.46
6 0.42
7 0.42
8 0.39
9 0.42
10 0.38
11 0.34
12 0.33
13 0.35
14 0.38
15 0.34
16 0.31
17 0.27
18 0.27
19 0.28
20 0.26
21 0.23
22 0.19
23 0.18
24 0.15
25 0.12
26 0.09
27 0.07
28 0.08
29 0.1
30 0.11
31 0.14
32 0.17
33 0.19
34 0.22
35 0.24
36 0.25
37 0.26
38 0.27
39 0.28
40 0.28
41 0.27
42 0.24
43 0.22
44 0.2
45 0.17
46 0.14
47 0.1
48 0.07
49 0.08
50 0.1
51 0.1
52 0.1
53 0.11
54 0.12
55 0.12
56 0.11
57 0.09
58 0.07
59 0.08
60 0.09
61 0.09
62 0.11
63 0.16
64 0.19
65 0.22
66 0.23
67 0.28
68 0.31
69 0.39
70 0.4
71 0.44
72 0.51
73 0.59
74 0.64
75 0.67
76 0.65
77 0.58
78 0.6
79 0.55
80 0.55
81 0.55
82 0.5
83 0.43
84 0.46
85 0.48
86 0.45
87 0.41
88 0.35
89 0.26
90 0.27
91 0.29
92 0.25
93 0.2
94 0.18
95 0.17
96 0.13
97 0.14
98 0.1
99 0.08
100 0.09
101 0.09
102 0.09
103 0.1
104 0.11
105 0.09
106 0.1
107 0.11
108 0.1
109 0.12
110 0.12
111 0.17
112 0.24
113 0.31
114 0.36
115 0.36
116 0.38
117 0.46
118 0.51
119 0.54
120 0.52
121 0.53
122 0.55
123 0.59
124 0.61
125 0.56
126 0.58
127 0.53
128 0.53
129 0.45
130 0.38
131 0.31
132 0.28
133 0.29
134 0.23
135 0.22
136 0.21
137 0.23
138 0.24
139 0.28
140 0.27
141 0.23
142 0.23
143 0.2
144 0.17
145 0.13
146 0.12
147 0.08
148 0.08
149 0.06
150 0.06
151 0.06
152 0.06
153 0.06
154 0.05
155 0.05
156 0.05
157 0.05
158 0.05
159 0.05
160 0.05
161 0.06
162 0.06
163 0.06
164 0.09
165 0.09
166 0.11
167 0.16
168 0.19
169 0.27
170 0.37
171 0.45
172 0.53
173 0.59
174 0.65
175 0.69
176 0.77
177 0.76
178 0.71
179 0.67
180 0.59
181 0.58
182 0.54
183 0.46
184 0.36
185 0.27
186 0.22
187 0.18
188 0.16
189 0.1
190 0.06
191 0.04
192 0.03
193 0.03
194 0.03
195 0.03
196 0.04
197 0.05
198 0.05
199 0.05
200 0.05
201 0.05
202 0.06
203 0.08
204 0.07
205 0.09
206 0.09
207 0.11
208 0.12
209 0.13
210 0.12
211 0.12
212 0.11
213 0.1
214 0.1
215 0.09
216 0.08
217 0.07
218 0.06
219 0.05
220 0.05
221 0.04
222 0.04
223 0.04
224 0.04
225 0.05
226 0.05
227 0.06
228 0.08
229 0.1
230 0.12
231 0.16
232 0.17
233 0.17
234 0.18
235 0.2
236 0.18
237 0.21
238 0.2
239 0.16
240 0.16
241 0.16
242 0.15
243 0.13
244 0.12
245 0.07
246 0.08
247 0.07
248 0.06
249 0.07
250 0.06
251 0.06
252 0.06
253 0.05
254 0.04
255 0.05
256 0.06
257 0.08
258 0.08
259 0.11
260 0.12
261 0.12
262 0.18
263 0.17
264 0.21
265 0.19
266 0.23
267 0.22
268 0.24
269 0.31
270 0.25
271 0.26
272 0.26
273 0.3
274 0.27
275 0.26
276 0.31
277 0.25
278 0.26
279 0.33
280 0.34
281 0.32
282 0.36
283 0.39
284 0.32
285 0.34
286 0.34
287 0.34
288 0.33
289 0.31
290 0.28
291 0.25
292 0.25
293 0.22
294 0.22
295 0.17
296 0.16
297 0.22
298 0.24
299 0.26
300 0.29
301 0.32
302 0.38
303 0.45
304 0.53
305 0.57
306 0.64
307 0.72
308 0.8
309 0.87
310 0.89
311 0.91
312 0.91
313 0.89
314 0.86
315 0.84
316 0.79
317 0.73
318 0.65
319 0.62
320 0.52
321 0.45
322 0.38
323 0.32
324 0.26
325 0.24
326 0.23
327 0.19
328 0.19
329 0.18
330 0.19
331 0.17
332 0.19
333 0.17
334 0.15
335 0.14
336 0.2
337 0.21
338 0.22
339 0.24
340 0.23
341 0.23
342 0.24
343 0.23
344 0.17
345 0.21
346 0.2
347 0.19
348 0.19
349 0.22
350 0.24
351 0.24
352 0.23
353 0.2
354 0.2
355 0.22
356 0.26
357 0.29
358 0.34
359 0.35
360 0.45
361 0.53
362 0.5
363 0.5
364 0.49
365 0.48
366 0.47
367 0.51
368 0.46
369 0.46
370 0.53
371 0.61
372 0.66
373 0.64
374 0.64
375 0.64
376 0.63
377 0.63
378 0.63
379 0.6
380 0.55
381 0.59
382 0.56
383 0.56
384 0.59
385 0.53
386 0.5
387 0.49
388 0.47
389 0.44
390 0.44
391 0.44
392 0.46
393 0.49
394 0.5
395 0.48
396 0.5
397 0.5
398 0.49
399 0.46
400 0.38
401 0.33
402 0.28
403 0.26
404 0.23
405 0.19
406 0.16
407 0.13
408 0.11
409 0.1
410 0.09