Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167HJ04

Protein Details
Accession A0A167HJ04    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPSKKGKKPGKGSRGKVNIRCWBasic
NLS Segment(s)
PositionSequence
4-16KKGKKPGKGSRGK
Subcellular Location(s) mito 16, cyto_nucl 6.5, cyto 6, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000571  Znf_CCCH  
Gene Ontology GO:0046872  F:metal ion binding  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MPSKKGKKPGKGSRGKVNIRCWFYEGKNISGCPTPDTCRYVHPWEPEWPTVASAQTVIRCNYFDHDGAPIGGGCPRGSSCRFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.84
3 0.81
4 0.79
5 0.77
6 0.7
7 0.65
8 0.58
9 0.53
10 0.45
11 0.47
12 0.39
13 0.34
14 0.33
15 0.32
16 0.3
17 0.28
18 0.27
19 0.21
20 0.21
21 0.21
22 0.22
23 0.24
24 0.23
25 0.22
26 0.27
27 0.29
28 0.31
29 0.31
30 0.3
31 0.33
32 0.37
33 0.34
34 0.31
35 0.26
36 0.23
37 0.21
38 0.18
39 0.13
40 0.1
41 0.12
42 0.13
43 0.15
44 0.15
45 0.15
46 0.16
47 0.17
48 0.19
49 0.2
50 0.17
51 0.16
52 0.17
53 0.17
54 0.16
55 0.16
56 0.12
57 0.1
58 0.11
59 0.12
60 0.1
61 0.11
62 0.12
63 0.17