Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167MCU6

Protein Details
Accession A0A167MCU6    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
90-109KLRNDDEKKRRERERYPRTTBasic
NLS Segment(s)
PositionSequence
98-101KRRE
260-268RLLKLKGRK
Subcellular Location(s) nucl 18.5, cyto_nucl 13.333, mito_nucl 11.166, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR029071  Ubiquitin-like_domsf  
IPR001012  UBX_dom  
Pfam View protein in Pfam  
PF00789  UBX  
PROSITE View protein in PROSITE  
PS50033  UBX  
Amino Acid Sequences MASTSNGKQPQAPASPVQGVPAESATFPPAAAPKPDFKVWNPPRDDSPSSPIPDLPDSHYEHSREELMSLYASTQRRLHAMTEGPLLTAKLRNDDEKKRRERERYPRTTIRIKFPDRTMLERTFGSDEKIKSVYKFVRDNLTEEAKPIKFILYQPPRQEYKVSDPAVHDKTLYELHFSPSSVLLLSFIDPELNRHDVPPPLLPEILAVAKDLPNAPPEPEKEVKPPSGGRTLGGGGEANAKGTGSGQSLSAQEKKDKLTRLLKLKGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.38
4 0.36
5 0.3
6 0.26
7 0.23
8 0.22
9 0.18
10 0.14
11 0.15
12 0.14
13 0.13
14 0.11
15 0.12
16 0.14
17 0.15
18 0.19
19 0.21
20 0.25
21 0.3
22 0.34
23 0.35
24 0.35
25 0.44
26 0.48
27 0.54
28 0.53
29 0.51
30 0.53
31 0.57
32 0.6
33 0.52
34 0.51
35 0.48
36 0.46
37 0.44
38 0.4
39 0.36
40 0.33
41 0.31
42 0.28
43 0.27
44 0.29
45 0.31
46 0.35
47 0.32
48 0.31
49 0.31
50 0.29
51 0.24
52 0.2
53 0.17
54 0.13
55 0.12
56 0.11
57 0.1
58 0.14
59 0.15
60 0.17
61 0.18
62 0.18
63 0.2
64 0.21
65 0.21
66 0.19
67 0.21
68 0.2
69 0.21
70 0.2
71 0.19
72 0.18
73 0.17
74 0.14
75 0.15
76 0.14
77 0.15
78 0.17
79 0.23
80 0.29
81 0.39
82 0.47
83 0.53
84 0.61
85 0.65
86 0.71
87 0.73
88 0.77
89 0.78
90 0.81
91 0.8
92 0.8
93 0.79
94 0.76
95 0.77
96 0.7
97 0.68
98 0.66
99 0.61
100 0.56
101 0.51
102 0.54
103 0.47
104 0.48
105 0.44
106 0.37
107 0.34
108 0.3
109 0.3
110 0.24
111 0.22
112 0.2
113 0.19
114 0.17
115 0.18
116 0.2
117 0.18
118 0.16
119 0.21
120 0.22
121 0.23
122 0.26
123 0.25
124 0.29
125 0.3
126 0.31
127 0.3
128 0.31
129 0.26
130 0.24
131 0.27
132 0.2
133 0.2
134 0.18
135 0.15
136 0.12
137 0.14
138 0.23
139 0.27
140 0.32
141 0.35
142 0.4
143 0.41
144 0.41
145 0.42
146 0.35
147 0.35
148 0.39
149 0.37
150 0.33
151 0.33
152 0.38
153 0.39
154 0.35
155 0.27
156 0.18
157 0.19
158 0.21
159 0.19
160 0.16
161 0.15
162 0.18
163 0.18
164 0.18
165 0.17
166 0.14
167 0.14
168 0.11
169 0.1
170 0.08
171 0.07
172 0.08
173 0.07
174 0.06
175 0.08
176 0.07
177 0.09
178 0.13
179 0.16
180 0.15
181 0.16
182 0.19
183 0.19
184 0.22
185 0.24
186 0.23
187 0.22
188 0.21
189 0.2
190 0.18
191 0.18
192 0.16
193 0.13
194 0.1
195 0.09
196 0.1
197 0.11
198 0.12
199 0.1
200 0.13
201 0.14
202 0.16
203 0.19
204 0.21
205 0.27
206 0.3
207 0.32
208 0.36
209 0.4
210 0.4
211 0.4
212 0.42
213 0.39
214 0.43
215 0.41
216 0.35
217 0.32
218 0.31
219 0.26
220 0.23
221 0.18
222 0.12
223 0.17
224 0.16
225 0.13
226 0.12
227 0.12
228 0.11
229 0.12
230 0.13
231 0.1
232 0.11
233 0.11
234 0.13
235 0.15
236 0.2
237 0.24
238 0.26
239 0.29
240 0.33
241 0.38
242 0.42
243 0.46
244 0.5
245 0.55
246 0.6
247 0.64
248 0.7