FuNGI

A0A167LS64

Protein Details

Accession

A0A167LS64

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
457-491	RSVDRRWSALYRRLSRKRRPVRVRRLSRSRYGAYC	Hydrophilic

NLS Segment(s)

Position	Sequence
468-484	RRLSRKRRPVRVRRLSR

Subcellular Location(s)

mito 23, cyto 2

Family & Domain DBs

InterPro	View protein in InterPro IPR006076 FAD-dep_OxRdtase IPR036188 FAD/NAD-bd_sf
Gene Ontology	GO:0016705 F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
Pfam	View protein in Pfam PF01266 DAO

Amino Acid Sequences

MPLTRRTPRKPPVGCTPSEAVAHSAAFIQWICVPYSELEVPITRPNSNRNMASGLAPTLRPLSEGMEVDAKPATLPHKKPSVSFWTARARQSDLIGHAAPFPHEADCVIIGSGMSGTLAAYFILLAEPDLPHGVVMLEAREAINAATACNGGHCRPDCYRGYSPYKKLVGKVQAMKILKNEMDTLHLVEKLVSEENIDCDFWRGRSFDAMMTDDCTADFRSSYDEYIKDAGNIDQVEWIEDKAAAQKATRLVNVKAAASFPASSFYPYKFTSHLLKRAMSMGLNLQIHTPATAVTAGDGFWMIDTPSGTIRTHKVLHATNGYASAIFPEFVGKIVPYYGQCSSIIPTKAFSGKNMLKHTMSLYEHRGDSTYLIQRSTDGTIILGGGEFVYREEHINNCDDSKVMPAITELLRNVMKDNFDGWGEEAHGEGFERDWAGIQGYANRSGILNCNAQLTSRSVDRRWSALYRRLSRKRRPVRVRRLSRSRYGAYCDLRKRGGYVDVGAALGGHRIARVLPDYQGTTGPQGQDVRT

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.7
2	0.65
3	0.6
4	0.53
5	0.47
6	0.41
7	0.32
8	0.27
9	0.25
10	0.19
11	0.16
12	0.12
13	0.13
14	0.11
15	0.11
16	0.12
17	0.13
18	0.14
19	0.14
20	0.15
21	0.15
22	0.2
23	0.19
24	0.17
25	0.18
26	0.19
27	0.2
28	0.26
29	0.28
30	0.26
31	0.28
32	0.34
33	0.4
34	0.44
35	0.44
36	0.4
37	0.4
38	0.38
39	0.37
40	0.32
41	0.27
42	0.23
43	0.21
44	0.19
45	0.19
46	0.17
47	0.16
48	0.15
49	0.15
50	0.17
51	0.18
52	0.19
53	0.22
54	0.22
55	0.22
56	0.22
57	0.19
58	0.14
59	0.16
60	0.21
61	0.24
62	0.28
63	0.34
64	0.42
65	0.43
66	0.45
67	0.5
68	0.52
69	0.5
70	0.49
71	0.49
72	0.51
73	0.55
74	0.57
75	0.53
76	0.48
77	0.43
78	0.43
79	0.4
80	0.32
81	0.32
82	0.28
83	0.26
84	0.23
85	0.22
86	0.19
87	0.17
88	0.15
89	0.12
90	0.11
91	0.11
92	0.1
93	0.1
94	0.1
95	0.09
96	0.08
97	0.07
98	0.07
99	0.06
100	0.05
101	0.04
102	0.03
103	0.03
104	0.03
105	0.04
106	0.03
107	0.03
108	0.03
109	0.03
110	0.04
111	0.04
112	0.04
113	0.05
114	0.05
115	0.06
116	0.07
117	0.06
118	0.06
119	0.06
120	0.06
121	0.06
122	0.06
123	0.06
124	0.05
125	0.06
126	0.06
127	0.06
128	0.06
129	0.05
130	0.08
131	0.07
132	0.07
133	0.08
134	0.08
135	0.08
136	0.09
137	0.11
138	0.09
139	0.15
140	0.16
141	0.2
142	0.22
143	0.29
144	0.3
145	0.35
146	0.39
147	0.41
148	0.49
149	0.53
150	0.55
151	0.57
152	0.61
153	0.55
154	0.53
155	0.53
156	0.51
157	0.5
158	0.52
159	0.47
160	0.48
161	0.47
162	0.45
163	0.39
164	0.36
165	0.29
166	0.24
167	0.22
168	0.15
169	0.17
170	0.17
171	0.17
172	0.14
173	0.14
174	0.13
175	0.12
176	0.12
177	0.11
178	0.11
179	0.09
180	0.08
181	0.08
182	0.11
183	0.11
184	0.11
185	0.1
186	0.12
187	0.12
188	0.12
189	0.14
190	0.13
191	0.12
192	0.14
193	0.15
194	0.14
195	0.16
196	0.17
197	0.15
198	0.16
199	0.15
200	0.13
201	0.12
202	0.11
203	0.1
204	0.08
205	0.08
206	0.06
207	0.1
208	0.11
209	0.12
210	0.14
211	0.13
212	0.15
213	0.16
214	0.16
215	0.13
216	0.13
217	0.12
218	0.12
219	0.12
220	0.1
221	0.1
222	0.1
223	0.11
224	0.1
225	0.1
226	0.07
227	0.07
228	0.07
229	0.09
230	0.11
231	0.1
232	0.1
233	0.12
234	0.15
235	0.17
236	0.19
237	0.19
238	0.17
239	0.22
240	0.23
241	0.21
242	0.17
243	0.16
244	0.14
245	0.12
246	0.12
247	0.08
248	0.09
249	0.08
250	0.1
251	0.11
252	0.11
253	0.14
254	0.15
255	0.16
256	0.15
257	0.18
258	0.24
259	0.27
260	0.33
261	0.31
262	0.31
263	0.3
264	0.31
265	0.29
266	0.21
267	0.17
268	0.12
269	0.14
270	0.14
271	0.13
272	0.12
273	0.11
274	0.11
275	0.11
276	0.09
277	0.05
278	0.05
279	0.05
280	0.05
281	0.04
282	0.05
283	0.04
284	0.04
285	0.04
286	0.04
287	0.03
288	0.04
289	0.03
290	0.04
291	0.04
292	0.05
293	0.06
294	0.08
295	0.09
296	0.11
297	0.12
298	0.16
299	0.17
300	0.17
301	0.21
302	0.21
303	0.24
304	0.25
305	0.24
306	0.2
307	0.2
308	0.19
309	0.14
310	0.12
311	0.1
312	0.08
313	0.07
314	0.06
315	0.06
316	0.06
317	0.07
318	0.07
319	0.06
320	0.06
321	0.06
322	0.08
323	0.07
324	0.11
325	0.11
326	0.12
327	0.13
328	0.13
329	0.15
330	0.19
331	0.2
332	0.17
333	0.17
334	0.18
335	0.23
336	0.23
337	0.22
338	0.25
339	0.27
340	0.34
341	0.37
342	0.38
343	0.33
344	0.34
345	0.34
346	0.31
347	0.3
348	0.27
349	0.27
350	0.26
351	0.26
352	0.25
353	0.25
354	0.19
355	0.18
356	0.2
357	0.23
358	0.21
359	0.21
360	0.21
361	0.2
362	0.22
363	0.22
364	0.17
365	0.11
366	0.1
367	0.09
368	0.09
369	0.08
370	0.06
371	0.04
372	0.04
373	0.04
374	0.04
375	0.04
376	0.05
377	0.06
378	0.07
379	0.09
380	0.11
381	0.13
382	0.16
383	0.17
384	0.16
385	0.16
386	0.15
387	0.14
388	0.15
389	0.14
390	0.12
391	0.1
392	0.1
393	0.13
394	0.14
395	0.16
396	0.12
397	0.15
398	0.16
399	0.16
400	0.18
401	0.17
402	0.18
403	0.16
404	0.17
405	0.15
406	0.14
407	0.15
408	0.13
409	0.12
410	0.12
411	0.11
412	0.11
413	0.09
414	0.09
415	0.08
416	0.08
417	0.07
418	0.07
419	0.07
420	0.07
421	0.07
422	0.08
423	0.09
424	0.1
425	0.1
426	0.15
427	0.17
428	0.2
429	0.19
430	0.19
431	0.18
432	0.18
433	0.23
434	0.21
435	0.21
436	0.19
437	0.22
438	0.21
439	0.21
440	0.22
441	0.2
442	0.2
443	0.23
444	0.27
445	0.26
446	0.33
447	0.35
448	0.36
449	0.39
450	0.43
451	0.44
452	0.48
453	0.57
454	0.6
455	0.68
456	0.75
457	0.8
458	0.83
459	0.87
460	0.89
461	0.9
462	0.92
463	0.92
464	0.93
465	0.94
466	0.95
467	0.95
468	0.95
469	0.91
470	0.89
471	0.85
472	0.8
473	0.73
474	0.69
475	0.67
476	0.64
477	0.66
478	0.64
479	0.61
480	0.59
481	0.56
482	0.51
483	0.46
484	0.44
485	0.37
486	0.32
487	0.29
488	0.26
489	0.25
490	0.23
491	0.19
492	0.14
493	0.11
494	0.09
495	0.07
496	0.06
497	0.06
498	0.07
499	0.1
500	0.13
501	0.14
502	0.16
503	0.2
504	0.22
505	0.23
506	0.25
507	0.24
508	0.26
509	0.27
510	0.26
511	0.27

A0A167LS64

3D AlphaFold-predicted Structure Viewer