Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167L1Q1

Protein Details
Accession A0A167L1Q1    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
107-129EVAQSPKEKKKRNPGYVNPERVKHydrophilic
NLS Segment(s)
PositionSequence
114-118EKKKR
244-273FVPRGRVMRGGFRGAPRGGFRGRGGPPGGP
Subcellular Location(s) nucl 15, cyto_nucl 14, cyto 11
Family & Domain DBs
Amino Acid Sequences MADNEATNGSSVLGLTFDNPPSDVGPIVSGTGAASQTTAALGEADHDASKIGDDKIEAGEEKSLEIPAEEKGPKSDGERNDTPPTVKPEEPEASEEAKSPTDKADGEVAQSPKEKKKRNPGYVNPERVKSGGVRDKPSADELVERMERIRLQNAKIVAKREEADKDAQAYQDTMAKDREAMKRRREVQNQINRQRQANAERKLGNVAGREWDADKGGPGPNSERGPNFERGPSFERGRGFDRGFVPRGRVMRGGFRGAPRGGFRGRGGPPGGPTSPGSERPAPAAASAKPDPTPAEAAATSKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.11
4 0.12
5 0.13
6 0.14
7 0.15
8 0.15
9 0.16
10 0.15
11 0.12
12 0.12
13 0.11
14 0.11
15 0.1
16 0.09
17 0.08
18 0.09
19 0.09
20 0.08
21 0.07
22 0.07
23 0.07
24 0.07
25 0.07
26 0.05
27 0.05
28 0.05
29 0.06
30 0.07
31 0.08
32 0.08
33 0.08
34 0.08
35 0.08
36 0.09
37 0.1
38 0.1
39 0.1
40 0.1
41 0.11
42 0.12
43 0.14
44 0.13
45 0.11
46 0.13
47 0.13
48 0.13
49 0.13
50 0.12
51 0.1
52 0.09
53 0.09
54 0.08
55 0.14
56 0.14
57 0.14
58 0.15
59 0.17
60 0.18
61 0.22
62 0.28
63 0.27
64 0.34
65 0.38
66 0.41
67 0.45
68 0.45
69 0.42
70 0.39
71 0.42
72 0.39
73 0.35
74 0.31
75 0.33
76 0.35
77 0.34
78 0.32
79 0.29
80 0.26
81 0.25
82 0.25
83 0.2
84 0.19
85 0.18
86 0.16
87 0.14
88 0.14
89 0.14
90 0.14
91 0.17
92 0.15
93 0.17
94 0.22
95 0.21
96 0.21
97 0.24
98 0.26
99 0.3
100 0.38
101 0.44
102 0.47
103 0.57
104 0.66
105 0.73
106 0.79
107 0.8
108 0.83
109 0.84
110 0.85
111 0.76
112 0.66
113 0.57
114 0.47
115 0.39
116 0.3
117 0.28
118 0.26
119 0.28
120 0.3
121 0.31
122 0.32
123 0.32
124 0.32
125 0.25
126 0.18
127 0.15
128 0.12
129 0.15
130 0.13
131 0.12
132 0.11
133 0.12
134 0.13
135 0.13
136 0.18
137 0.17
138 0.18
139 0.21
140 0.24
141 0.27
142 0.28
143 0.3
144 0.26
145 0.25
146 0.24
147 0.24
148 0.23
149 0.2
150 0.2
151 0.18
152 0.19
153 0.18
154 0.18
155 0.15
156 0.13
157 0.12
158 0.13
159 0.13
160 0.12
161 0.12
162 0.12
163 0.14
164 0.19
165 0.27
166 0.31
167 0.38
168 0.43
169 0.5
170 0.57
171 0.65
172 0.66
173 0.66
174 0.68
175 0.72
176 0.76
177 0.76
178 0.78
179 0.7
180 0.65
181 0.59
182 0.54
183 0.53
184 0.52
185 0.47
186 0.45
187 0.44
188 0.43
189 0.43
190 0.39
191 0.32
192 0.24
193 0.21
194 0.18
195 0.17
196 0.17
197 0.16
198 0.15
199 0.14
200 0.12
201 0.12
202 0.11
203 0.14
204 0.14
205 0.14
206 0.17
207 0.21
208 0.23
209 0.25
210 0.24
211 0.26
212 0.3
213 0.34
214 0.32
215 0.31
216 0.3
217 0.33
218 0.36
219 0.37
220 0.35
221 0.34
222 0.35
223 0.35
224 0.38
225 0.39
226 0.36
227 0.35
228 0.37
229 0.39
230 0.4
231 0.37
232 0.37
233 0.35
234 0.37
235 0.34
236 0.34
237 0.3
238 0.35
239 0.38
240 0.39
241 0.38
242 0.38
243 0.41
244 0.37
245 0.39
246 0.33
247 0.34
248 0.31
249 0.31
250 0.3
251 0.32
252 0.33
253 0.36
254 0.35
255 0.32
256 0.33
257 0.35
258 0.35
259 0.29
260 0.28
261 0.28
262 0.31
263 0.33
264 0.36
265 0.34
266 0.35
267 0.36
268 0.37
269 0.32
270 0.3
271 0.3
272 0.25
273 0.28
274 0.29
275 0.29
276 0.27
277 0.28
278 0.28
279 0.27
280 0.29
281 0.23
282 0.25
283 0.23