Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167K1A3

Protein Details
Accession A0A167K1A3   
Localization Confidence High
Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
132-160YFNPTKKQKVVEPKKQKRKKKLDIDALGIHydrophilic
NLS Segment(s)
PositionSequence
7-21GRGGRGGGFGRGRGR
138-152KQKVVEPKKQKRKKK
Subcellular Location(s) nucl 21, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024661  RNA_pol_III_Rpc31  
Gene Ontology GO:0005666  C:RNA polymerase III complex  
GO:0006383  P:transcription by RNA polymerase III  
Pfam View protein in Pfam  
PF11705  RNA_pol_3_Rpc31  
Amino Acid Sequences MSGRGGGRGGRGGGFGRGRGRGGFGGPSLPPGLDFRDIQASMAAPSAQYPPMDVPNMTALNEMESKAVTYQVEFLDRLRGSKYWIVEEETKKTNEIERWFDRVRQKEKLDTKALKPEDFNPEFFPASLWDGYFNPTKKQKVVEPKKQKRKKKLDIDALGIDDKDGEGEANDDDLDGDEEEQQEDYDVEDLEGDDDYEANYFDNGENDDDDDMNDDGERGGGDYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.25
4 0.26
5 0.27
6 0.26
7 0.28
8 0.23
9 0.23
10 0.22
11 0.18
12 0.19
13 0.18
14 0.19
15 0.17
16 0.15
17 0.14
18 0.14
19 0.17
20 0.16
21 0.17
22 0.17
23 0.22
24 0.23
25 0.22
26 0.21
27 0.18
28 0.16
29 0.16
30 0.14
31 0.07
32 0.09
33 0.1
34 0.11
35 0.1
36 0.11
37 0.12
38 0.15
39 0.17
40 0.16
41 0.15
42 0.19
43 0.19
44 0.18
45 0.17
46 0.14
47 0.15
48 0.16
49 0.15
50 0.1
51 0.09
52 0.09
53 0.09
54 0.1
55 0.08
56 0.07
57 0.09
58 0.1
59 0.12
60 0.12
61 0.12
62 0.17
63 0.17
64 0.18
65 0.17
66 0.17
67 0.19
68 0.21
69 0.22
70 0.18
71 0.19
72 0.22
73 0.27
74 0.29
75 0.3
76 0.3
77 0.29
78 0.27
79 0.27
80 0.27
81 0.25
82 0.26
83 0.29
84 0.28
85 0.34
86 0.34
87 0.39
88 0.42
89 0.46
90 0.47
91 0.47
92 0.47
93 0.49
94 0.54
95 0.54
96 0.55
97 0.5
98 0.48
99 0.49
100 0.49
101 0.41
102 0.36
103 0.34
104 0.35
105 0.33
106 0.32
107 0.26
108 0.26
109 0.25
110 0.24
111 0.21
112 0.13
113 0.14
114 0.13
115 0.1
116 0.1
117 0.1
118 0.12
119 0.17
120 0.16
121 0.19
122 0.25
123 0.27
124 0.28
125 0.3
126 0.34
127 0.41
128 0.51
129 0.57
130 0.63
131 0.71
132 0.8
133 0.87
134 0.9
135 0.9
136 0.91
137 0.9
138 0.9
139 0.89
140 0.89
141 0.84
142 0.79
143 0.69
144 0.6
145 0.5
146 0.39
147 0.28
148 0.18
149 0.13
150 0.08
151 0.06
152 0.04
153 0.03
154 0.05
155 0.05
156 0.05
157 0.05
158 0.05
159 0.05
160 0.06
161 0.07
162 0.06
163 0.07
164 0.07
165 0.08
166 0.09
167 0.09
168 0.08
169 0.08
170 0.07
171 0.08
172 0.07
173 0.07
174 0.07
175 0.07
176 0.07
177 0.07
178 0.07
179 0.06
180 0.05
181 0.05
182 0.05
183 0.06
184 0.06
185 0.06
186 0.06
187 0.07
188 0.07
189 0.09
190 0.11
191 0.12
192 0.12
193 0.13
194 0.14
195 0.13
196 0.13
197 0.14
198 0.13
199 0.11
200 0.11
201 0.1
202 0.08
203 0.08
204 0.08