Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167L322

Protein Details
Accession A0A167L322    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
85-117IWWGRAIKRSDRDKKRRSQRRASKMPPRPSMKHBasic
NLS Segment(s)
PositionSequence
90-113AIKRSDRDKKRRSQRRASKMPPRP
220-220R
Subcellular Location(s) nucl 7.5, extr 7, cyto_nucl 5.5, mito 5, plas 3, cyto 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSPSATLPSGTTTDPSTSVPTSLLINSAAPPGDAGPSVVTVTYQVGPTDTPQSSGGGSNIPIGAIVGGTLGGMAIVALVVFAWIWWGRAIKRSDRDKKRRSQRRASKMPPRPSMKHVSSSTGSSFLTRDGKTVSFEFVSPAGAVAGAAVPALSKHAPPPRHAPPTRVPPPARRTSASALPPGAAAPGATATATVLVTPPEEPQPPRVRSPERPEKSPYRPSRRREAALAVTHARTSSGGSYRPSPLSQGASFAASRDPSPGAQAQEFRGDPSQSSSAQSSAGPSSAAQSTSTQSTQSTSKTPSPTAPPTPPFLRKSPTSKTKTNPSLVALHAAATTPTPNLSLLTQADGRVNRLSALSVQPASPSEWEHEPMPPAHPAYQQQQQYQMQQYQLQHGLAPHQDEDEILWRGSRVEMTPSPEGDDDDRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.21
4 0.22
5 0.21
6 0.21
7 0.2
8 0.18
9 0.18
10 0.17
11 0.17
12 0.13
13 0.13
14 0.14
15 0.15
16 0.14
17 0.12
18 0.12
19 0.11
20 0.12
21 0.11
22 0.11
23 0.09
24 0.1
25 0.1
26 0.1
27 0.09
28 0.08
29 0.11
30 0.12
31 0.12
32 0.11
33 0.12
34 0.12
35 0.15
36 0.2
37 0.18
38 0.19
39 0.19
40 0.2
41 0.2
42 0.21
43 0.19
44 0.14
45 0.15
46 0.14
47 0.14
48 0.12
49 0.11
50 0.09
51 0.08
52 0.06
53 0.05
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.04
71 0.05
72 0.06
73 0.07
74 0.11
75 0.12
76 0.19
77 0.24
78 0.3
79 0.39
80 0.5
81 0.59
82 0.68
83 0.77
84 0.8
85 0.86
86 0.89
87 0.91
88 0.9
89 0.91
90 0.9
91 0.9
92 0.92
93 0.91
94 0.91
95 0.9
96 0.89
97 0.87
98 0.84
99 0.78
100 0.73
101 0.73
102 0.66
103 0.64
104 0.56
105 0.52
106 0.45
107 0.44
108 0.38
109 0.31
110 0.27
111 0.2
112 0.19
113 0.17
114 0.21
115 0.19
116 0.18
117 0.19
118 0.2
119 0.21
120 0.22
121 0.21
122 0.16
123 0.16
124 0.16
125 0.13
126 0.13
127 0.1
128 0.09
129 0.07
130 0.06
131 0.06
132 0.04
133 0.04
134 0.03
135 0.03
136 0.03
137 0.02
138 0.03
139 0.05
140 0.05
141 0.06
142 0.11
143 0.18
144 0.21
145 0.24
146 0.32
147 0.38
148 0.47
149 0.48
150 0.49
151 0.5
152 0.58
153 0.62
154 0.62
155 0.57
156 0.56
157 0.62
158 0.64
159 0.6
160 0.52
161 0.49
162 0.45
163 0.49
164 0.43
165 0.38
166 0.3
167 0.27
168 0.25
169 0.2
170 0.16
171 0.09
172 0.06
173 0.04
174 0.04
175 0.04
176 0.03
177 0.03
178 0.03
179 0.04
180 0.04
181 0.04
182 0.04
183 0.04
184 0.05
185 0.05
186 0.06
187 0.08
188 0.1
189 0.11
190 0.18
191 0.27
192 0.29
193 0.32
194 0.37
195 0.4
196 0.45
197 0.54
198 0.58
199 0.52
200 0.54
201 0.56
202 0.57
203 0.59
204 0.62
205 0.63
206 0.63
207 0.68
208 0.68
209 0.73
210 0.71
211 0.66
212 0.59
213 0.54
214 0.5
215 0.43
216 0.42
217 0.34
218 0.28
219 0.26
220 0.23
221 0.18
222 0.12
223 0.1
224 0.1
225 0.11
226 0.13
227 0.14
228 0.17
229 0.19
230 0.21
231 0.2
232 0.19
233 0.19
234 0.2
235 0.19
236 0.18
237 0.16
238 0.16
239 0.16
240 0.14
241 0.14
242 0.1
243 0.11
244 0.1
245 0.11
246 0.09
247 0.12
248 0.14
249 0.15
250 0.16
251 0.17
252 0.17
253 0.2
254 0.2
255 0.19
256 0.19
257 0.18
258 0.16
259 0.19
260 0.2
261 0.16
262 0.18
263 0.17
264 0.15
265 0.16
266 0.16
267 0.13
268 0.12
269 0.11
270 0.09
271 0.08
272 0.1
273 0.1
274 0.11
275 0.1
276 0.11
277 0.12
278 0.15
279 0.15
280 0.14
281 0.13
282 0.15
283 0.16
284 0.17
285 0.19
286 0.21
287 0.26
288 0.29
289 0.3
290 0.32
291 0.36
292 0.4
293 0.42
294 0.44
295 0.41
296 0.43
297 0.48
298 0.51
299 0.48
300 0.46
301 0.45
302 0.45
303 0.5
304 0.54
305 0.58
306 0.58
307 0.61
308 0.63
309 0.68
310 0.7
311 0.67
312 0.6
313 0.53
314 0.51
315 0.44
316 0.42
317 0.31
318 0.24
319 0.2
320 0.17
321 0.14
322 0.1
323 0.11
324 0.07
325 0.08
326 0.08
327 0.08
328 0.09
329 0.09
330 0.12
331 0.12
332 0.15
333 0.16
334 0.16
335 0.2
336 0.2
337 0.22
338 0.21
339 0.2
340 0.18
341 0.17
342 0.17
343 0.15
344 0.18
345 0.19
346 0.18
347 0.18
348 0.18
349 0.19
350 0.2
351 0.19
352 0.17
353 0.17
354 0.19
355 0.21
356 0.22
357 0.23
358 0.24
359 0.24
360 0.25
361 0.25
362 0.25
363 0.26
364 0.29
365 0.31
366 0.33
367 0.4
368 0.43
369 0.42
370 0.48
371 0.49
372 0.51
373 0.54
374 0.52
375 0.47
376 0.48
377 0.47
378 0.45
379 0.45
380 0.38
381 0.33
382 0.3
383 0.32
384 0.29
385 0.3
386 0.24
387 0.21
388 0.21
389 0.19
390 0.21
391 0.21
392 0.21
393 0.18
394 0.18
395 0.17
396 0.18
397 0.19
398 0.19
399 0.15
400 0.2
401 0.24
402 0.3
403 0.34
404 0.34
405 0.36
406 0.34
407 0.35