Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167N1S6

Protein Details
Accession A0A167N1S6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
54-78ISRGIRSYRESKRRRRLAVKVGTGRHydrophilic
NLS Segment(s)
PositionSequence
60-80SYRESKRRRRLAVKVGTGRKG
Subcellular Location(s) plas 9, mito 6, E.R. 5, cyto_mito 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSTITPTSTDGAASATSSSNMLLQSFKSKVVLTATIGGVLVLAVTIFLAVFKISRGIRSYRESKRRRRLAVKVGTGRKGRNAYEIFEWEGVPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.08
4 0.08
5 0.09
6 0.09
7 0.09
8 0.09
9 0.09
10 0.09
11 0.09
12 0.14
13 0.15
14 0.15
15 0.15
16 0.15
17 0.16
18 0.18
19 0.18
20 0.14
21 0.16
22 0.15
23 0.13
24 0.13
25 0.11
26 0.08
27 0.07
28 0.05
29 0.02
30 0.02
31 0.02
32 0.01
33 0.02
34 0.01
35 0.02
36 0.02
37 0.02
38 0.02
39 0.03
40 0.07
41 0.07
42 0.09
43 0.12
44 0.15
45 0.19
46 0.25
47 0.34
48 0.39
49 0.5
50 0.57
51 0.65
52 0.74
53 0.79
54 0.82
55 0.82
56 0.82
57 0.82
58 0.83
59 0.81
60 0.8
61 0.77
62 0.76
63 0.71
64 0.64
65 0.61
66 0.57
67 0.49
68 0.48
69 0.44
70 0.4
71 0.41
72 0.42
73 0.38
74 0.33