Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167HNP1

Protein Details
Accession A0A167HNP1    Localization Confidence High Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MPAKKKPPTKQQPRPRRLKPTEPPPQTDEHydrophilic
249-271LSKASSKSSLKRRRHEHESDSSHHydrophilic
NLS Segment(s)
PositionSequence
4-19KKKPPTKQQPRPRRLK
225-262GARGGNKGKAVERGSGGSGGSRPALSKASSKSSLKRRR
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MPAKKKPPTKQQPRPRRLKPTEPPPQTDEAIAAEAEKIQMEINVDLFWEEDLRERAAMAADEDTLSSFRDAVNRLWDKFPDTIAGFPAHKVAFLQKNSQNIWRVSQPEGGTTVIPKLPYKPVATTGEFQDLGPRDEGEAALASAKTASSGLPPLTPSPALHTIPLPNETATTATTARTAGPSRASRTPAPTTATAATTTTTTPAPEPSPSSSEAEAEPRYNFRGGARGGNKGKAVERGSGGSGGSRPALSKASSKSSLKRRRHEHESDSSHETEEDDGDAGDSEAEEEEEDGGPDFPIRMKGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.93
3 0.93
4 0.91
5 0.91
6 0.9
7 0.89
8 0.9
9 0.86
10 0.81
11 0.75
12 0.71
13 0.61
14 0.51
15 0.41
16 0.32
17 0.26
18 0.2
19 0.16
20 0.11
21 0.1
22 0.1
23 0.08
24 0.07
25 0.06
26 0.07
27 0.09
28 0.1
29 0.1
30 0.09
31 0.09
32 0.09
33 0.09
34 0.08
35 0.07
36 0.07
37 0.1
38 0.12
39 0.13
40 0.13
41 0.13
42 0.13
43 0.13
44 0.13
45 0.11
46 0.09
47 0.09
48 0.09
49 0.09
50 0.09
51 0.08
52 0.09
53 0.08
54 0.07
55 0.07
56 0.11
57 0.13
58 0.15
59 0.24
60 0.27
61 0.29
62 0.32
63 0.32
64 0.32
65 0.3
66 0.29
67 0.23
68 0.2
69 0.19
70 0.18
71 0.2
72 0.17
73 0.16
74 0.19
75 0.14
76 0.13
77 0.13
78 0.18
79 0.22
80 0.24
81 0.31
82 0.31
83 0.36
84 0.38
85 0.42
86 0.41
87 0.36
88 0.37
89 0.33
90 0.33
91 0.3
92 0.33
93 0.28
94 0.23
95 0.24
96 0.22
97 0.18
98 0.16
99 0.15
100 0.11
101 0.12
102 0.12
103 0.12
104 0.15
105 0.19
106 0.2
107 0.19
108 0.23
109 0.27
110 0.29
111 0.28
112 0.26
113 0.26
114 0.25
115 0.23
116 0.23
117 0.19
118 0.18
119 0.17
120 0.15
121 0.12
122 0.12
123 0.12
124 0.07
125 0.06
126 0.05
127 0.05
128 0.05
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.06
137 0.06
138 0.07
139 0.08
140 0.08
141 0.09
142 0.1
143 0.09
144 0.12
145 0.16
146 0.16
147 0.16
148 0.16
149 0.17
150 0.17
151 0.19
152 0.15
153 0.11
154 0.11
155 0.11
156 0.11
157 0.09
158 0.1
159 0.09
160 0.08
161 0.09
162 0.09
163 0.09
164 0.1
165 0.11
166 0.11
167 0.16
168 0.19
169 0.22
170 0.26
171 0.29
172 0.28
173 0.33
174 0.35
175 0.32
176 0.33
177 0.29
178 0.28
179 0.26
180 0.25
181 0.2
182 0.17
183 0.15
184 0.12
185 0.11
186 0.1
187 0.09
188 0.09
189 0.09
190 0.11
191 0.12
192 0.13
193 0.15
194 0.17
195 0.19
196 0.21
197 0.23
198 0.21
199 0.21
200 0.2
201 0.21
202 0.2
203 0.19
204 0.18
205 0.18
206 0.19
207 0.19
208 0.19
209 0.15
210 0.2
211 0.2
212 0.27
213 0.28
214 0.34
215 0.36
216 0.39
217 0.4
218 0.35
219 0.36
220 0.34
221 0.34
222 0.28
223 0.27
224 0.26
225 0.25
226 0.24
227 0.22
228 0.17
229 0.15
230 0.13
231 0.12
232 0.11
233 0.1
234 0.12
235 0.14
236 0.14
237 0.19
238 0.22
239 0.28
240 0.34
241 0.38
242 0.44
243 0.53
244 0.62
245 0.66
246 0.72
247 0.74
248 0.77
249 0.83
250 0.83
251 0.8
252 0.8
253 0.77
254 0.73
255 0.69
256 0.61
257 0.52
258 0.43
259 0.36
260 0.26
261 0.2
262 0.16
263 0.11
264 0.1
265 0.09
266 0.09
267 0.08
268 0.07
269 0.06
270 0.06
271 0.06
272 0.06
273 0.06
274 0.06
275 0.07
276 0.08
277 0.08
278 0.08
279 0.09
280 0.09
281 0.09
282 0.09
283 0.1