Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167HAE8

Protein Details
Accession A0A167HAE8    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
201-220VLNKLKKMELRGSRRRKAKEBasic
NLS Segment(s)
PositionSequence
128-141AKAKKRQLRGSKSR
205-220LKKMELRGSRRRKAKE
Subcellular Location(s) cyto 10.5, cyto_mito 7, cysk 6, nucl 5, mito 2.5
Family & Domain DBs
Amino Acid Sequences MSSLAKLLHDKVPIVDIEAIKLWFLCMDVQTVGHVVTLAHPIQQDAAAAFDAIMEFACDHGVGMCLLCRLTLSALHWKYPDLGGIDILDWDHDSQTFKKPWLFDETELREYLEHCRGLPKDENFKSEAKAKKRQLRGSKSRAGGASATSEVNPGEKGNTILVEEDMGAAKEKEGPVAGESSMGTIPVPQSEGDISLDEREVLNKLKKMELRGSRRRKAKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.19
4 0.19
5 0.21
6 0.2
7 0.17
8 0.17
9 0.14
10 0.09
11 0.1
12 0.09
13 0.08
14 0.1
15 0.1
16 0.1
17 0.11
18 0.11
19 0.1
20 0.09
21 0.08
22 0.06
23 0.07
24 0.11
25 0.11
26 0.12
27 0.12
28 0.12
29 0.13
30 0.13
31 0.12
32 0.08
33 0.09
34 0.07
35 0.07
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.07
59 0.1
60 0.19
61 0.2
62 0.22
63 0.22
64 0.22
65 0.22
66 0.21
67 0.2
68 0.12
69 0.11
70 0.1
71 0.1
72 0.1
73 0.08
74 0.08
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.07
81 0.09
82 0.15
83 0.17
84 0.18
85 0.2
86 0.2
87 0.22
88 0.27
89 0.28
90 0.23
91 0.3
92 0.33
93 0.32
94 0.32
95 0.3
96 0.23
97 0.21
98 0.23
99 0.19
100 0.14
101 0.13
102 0.17
103 0.17
104 0.21
105 0.26
106 0.26
107 0.32
108 0.33
109 0.36
110 0.34
111 0.35
112 0.33
113 0.34
114 0.38
115 0.35
116 0.43
117 0.49
118 0.55
119 0.62
120 0.69
121 0.72
122 0.75
123 0.78
124 0.76
125 0.76
126 0.69
127 0.64
128 0.56
129 0.47
130 0.37
131 0.28
132 0.23
133 0.16
134 0.15
135 0.11
136 0.12
137 0.1
138 0.1
139 0.1
140 0.08
141 0.08
142 0.08
143 0.09
144 0.09
145 0.1
146 0.09
147 0.09
148 0.09
149 0.08
150 0.08
151 0.07
152 0.07
153 0.07
154 0.07
155 0.07
156 0.07
157 0.1
158 0.1
159 0.1
160 0.11
161 0.11
162 0.11
163 0.13
164 0.12
165 0.1
166 0.1
167 0.11
168 0.1
169 0.09
170 0.08
171 0.08
172 0.08
173 0.08
174 0.09
175 0.08
176 0.09
177 0.1
178 0.11
179 0.12
180 0.12
181 0.13
182 0.13
183 0.13
184 0.12
185 0.12
186 0.12
187 0.13
188 0.18
189 0.24
190 0.26
191 0.28
192 0.35
193 0.38
194 0.43
195 0.5
196 0.54
197 0.58
198 0.66
199 0.74
200 0.76