Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167NZU4

Protein Details
Accession A0A167NZU4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-22ASEAPRTVKPKRERIKFEEAWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 12, cyto 3.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016159  Cullin_repeat-like_dom_sf  
Amino Acid Sequences MASEAPRTVKPKRERIKFEEAWPVIQGLLDRALRQALVEGREPTKFGGLSYADFMEVYDKVFNLTTSVYVSEVKPIYPALSKYFFEIADEMLAQVASGHVGNNDHAFLLSYLESYDHFLSAAMLLPHTFGMFERHWLKRYKDEWFYKPNDREEVPPPGMEWSNPSAPGGTGPSHGTTQVIGSMSGNAITTSRRERVLVPKPRAELEGEIMQWDSATAAGAPESQELAKLLWPPDGNPTTSRDGALGVIDGKEMAQCAARKYSSLPANVYMQLVPTLLRLWRLATVKHFGTDNDASMPSIVHKMQERGELREDVELVKRLAKCFWATGVLEQDMGFEELVAVLRSAC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.85
4 0.79
5 0.76
6 0.76
7 0.67
8 0.59
9 0.5
10 0.43
11 0.32
12 0.28
13 0.22
14 0.13
15 0.17
16 0.16
17 0.15
18 0.16
19 0.17
20 0.16
21 0.15
22 0.18
23 0.17
24 0.19
25 0.22
26 0.25
27 0.26
28 0.27
29 0.28
30 0.25
31 0.25
32 0.21
33 0.18
34 0.19
35 0.19
36 0.19
37 0.21
38 0.2
39 0.16
40 0.16
41 0.16
42 0.12
43 0.11
44 0.11
45 0.1
46 0.09
47 0.1
48 0.11
49 0.11
50 0.1
51 0.1
52 0.1
53 0.1
54 0.11
55 0.11
56 0.12
57 0.12
58 0.17
59 0.17
60 0.16
61 0.15
62 0.15
63 0.16
64 0.17
65 0.19
66 0.18
67 0.22
68 0.22
69 0.24
70 0.26
71 0.24
72 0.22
73 0.21
74 0.16
75 0.13
76 0.12
77 0.1
78 0.08
79 0.07
80 0.06
81 0.05
82 0.04
83 0.04
84 0.04
85 0.04
86 0.05
87 0.06
88 0.07
89 0.08
90 0.08
91 0.07
92 0.07
93 0.08
94 0.07
95 0.08
96 0.07
97 0.07
98 0.07
99 0.07
100 0.07
101 0.09
102 0.1
103 0.08
104 0.08
105 0.08
106 0.08
107 0.08
108 0.09
109 0.07
110 0.06
111 0.06
112 0.07
113 0.07
114 0.06
115 0.06
116 0.05
117 0.09
118 0.09
119 0.14
120 0.2
121 0.22
122 0.26
123 0.31
124 0.33
125 0.37
126 0.4
127 0.42
128 0.46
129 0.5
130 0.52
131 0.55
132 0.58
133 0.57
134 0.59
135 0.55
136 0.5
137 0.44
138 0.42
139 0.39
140 0.4
141 0.32
142 0.28
143 0.25
144 0.23
145 0.22
146 0.18
147 0.17
148 0.13
149 0.13
150 0.14
151 0.13
152 0.11
153 0.11
154 0.12
155 0.11
156 0.08
157 0.08
158 0.09
159 0.1
160 0.1
161 0.1
162 0.1
163 0.08
164 0.07
165 0.08
166 0.07
167 0.06
168 0.06
169 0.06
170 0.06
171 0.06
172 0.06
173 0.05
174 0.05
175 0.05
176 0.07
177 0.1
178 0.12
179 0.13
180 0.14
181 0.17
182 0.26
183 0.36
184 0.43
185 0.45
186 0.47
187 0.48
188 0.48
189 0.46
190 0.38
191 0.29
192 0.23
193 0.2
194 0.16
195 0.15
196 0.14
197 0.13
198 0.11
199 0.09
200 0.06
201 0.03
202 0.03
203 0.03
204 0.03
205 0.03
206 0.04
207 0.05
208 0.05
209 0.06
210 0.05
211 0.06
212 0.06
213 0.07
214 0.08
215 0.11
216 0.11
217 0.14
218 0.14
219 0.14
220 0.21
221 0.23
222 0.22
223 0.21
224 0.25
225 0.26
226 0.27
227 0.26
228 0.19
229 0.18
230 0.17
231 0.15
232 0.11
233 0.08
234 0.07
235 0.07
236 0.06
237 0.06
238 0.05
239 0.05
240 0.05
241 0.08
242 0.1
243 0.12
244 0.17
245 0.17
246 0.18
247 0.2
248 0.28
249 0.29
250 0.31
251 0.3
252 0.28
253 0.31
254 0.32
255 0.3
256 0.23
257 0.18
258 0.16
259 0.14
260 0.11
261 0.09
262 0.1
263 0.09
264 0.11
265 0.11
266 0.12
267 0.17
268 0.19
269 0.21
270 0.24
271 0.29
272 0.28
273 0.29
274 0.29
275 0.23
276 0.28
277 0.27
278 0.24
279 0.22
280 0.21
281 0.2
282 0.19
283 0.19
284 0.13
285 0.16
286 0.14
287 0.15
288 0.18
289 0.22
290 0.24
291 0.33
292 0.34
293 0.36
294 0.4
295 0.38
296 0.36
297 0.35
298 0.33
299 0.26
300 0.28
301 0.26
302 0.23
303 0.26
304 0.28
305 0.27
306 0.28
307 0.29
308 0.27
309 0.26
310 0.28
311 0.27
312 0.26
313 0.29
314 0.32
315 0.29
316 0.27
317 0.25
318 0.23
319 0.19
320 0.19
321 0.14
322 0.09
323 0.08
324 0.08
325 0.09
326 0.09