Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167QZR4

Protein Details
Accession A0A167QZR4    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
55-76LPDLPVSPRRRRVRRATGACSAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13, nucl 11.5, cyto 11.5, mito 2, extr 2
Family & Domain DBs
Amino Acid Sequences MPNDQPAADSAPVPASPPATPTIRFREPRPPPLTLNVPVDHEPKLARDPEGKDVLPDLPVSPRRRRVRRATGACSALLAGGGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.12
4 0.14
5 0.17
6 0.17
7 0.19
8 0.22
9 0.29
10 0.35
11 0.37
12 0.39
13 0.46
14 0.5
15 0.58
16 0.57
17 0.53
18 0.47
19 0.5
20 0.51
21 0.44
22 0.41
23 0.32
24 0.31
25 0.29
26 0.28
27 0.24
28 0.2
29 0.16
30 0.14
31 0.16
32 0.14
33 0.14
34 0.17
35 0.19
36 0.23
37 0.27
38 0.25
39 0.23
40 0.23
41 0.22
42 0.18
43 0.16
44 0.12
45 0.14
46 0.21
47 0.27
48 0.33
49 0.42
50 0.52
51 0.6
52 0.68
53 0.73
54 0.77
55 0.82
56 0.84
57 0.81
58 0.78
59 0.72
60 0.63
61 0.53
62 0.42
63 0.31
64 0.22