Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167QRV7

Protein Details
Accession A0A167QRV7    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
128-158DKWRVVLDLARKKKRRKGKQSKQHQGNHGGGBasic
NLS Segment(s)
PositionSequence
88-99RKRKGGDEKRER
123-149KKRQEDKWRVVLDLARKKKRRKGKQSK
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MATSPRSPSPTFDQLTSLFDQAFGNASSLVSSWISEGPRHGYPAQAESEELLRQWRDRPARLGLGAPVRRTDSAPLSQLNRHLAAGTRKRKGGDEKRERNAEKASDEDQESRYQMSGRPSSAKKRQEDKWRVVLDLARKKKRRKGKQSKQHQGNHGGGDSTRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.39
3 0.36
4 0.29
5 0.2
6 0.19
7 0.18
8 0.15
9 0.15
10 0.12
11 0.1
12 0.09
13 0.09
14 0.08
15 0.08
16 0.1
17 0.08
18 0.08
19 0.08
20 0.11
21 0.12
22 0.12
23 0.14
24 0.17
25 0.18
26 0.21
27 0.2
28 0.2
29 0.2
30 0.23
31 0.23
32 0.19
33 0.18
34 0.15
35 0.16
36 0.14
37 0.13
38 0.12
39 0.11
40 0.12
41 0.15
42 0.22
43 0.25
44 0.27
45 0.31
46 0.33
47 0.35
48 0.34
49 0.32
50 0.28
51 0.31
52 0.3
53 0.27
54 0.24
55 0.23
56 0.22
57 0.22
58 0.21
59 0.17
60 0.17
61 0.18
62 0.19
63 0.19
64 0.2
65 0.22
66 0.21
67 0.18
68 0.16
69 0.15
70 0.15
71 0.21
72 0.29
73 0.33
74 0.34
75 0.35
76 0.36
77 0.39
78 0.47
79 0.49
80 0.51
81 0.56
82 0.62
83 0.67
84 0.74
85 0.71
86 0.64
87 0.58
88 0.49
89 0.4
90 0.35
91 0.31
92 0.25
93 0.26
94 0.24
95 0.22
96 0.21
97 0.2
98 0.18
99 0.16
100 0.14
101 0.16
102 0.2
103 0.22
104 0.22
105 0.28
106 0.31
107 0.4
108 0.49
109 0.53
110 0.55
111 0.59
112 0.65
113 0.7
114 0.75
115 0.73
116 0.73
117 0.67
118 0.61
119 0.56
120 0.51
121 0.5
122 0.52
123 0.54
124 0.55
125 0.61
126 0.69
127 0.76
128 0.83
129 0.84
130 0.86
131 0.87
132 0.88
133 0.91
134 0.94
135 0.96
136 0.95
137 0.92
138 0.89
139 0.86
140 0.79
141 0.73
142 0.62
143 0.52