Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167FQ68

Protein Details
Accession A0A167FQ68   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
7-31HHRTTPTPSPARQRRRSPRGAVVDDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000644  CBS_dom  
IPR046342  CBS_dom_sf  
Pfam View protein in Pfam  
PF00571  CBS  
Amino Acid Sequences MARRTPHHRTTPTPSPARQRRRSPRGAVVDDLQLPPAFCLPATAPVSRAITEAYERDFSQIPILSEGRRVLGYVSVGRLKEGWEKGQVNPDVAISNYTTRFPTTSKPYRVITPDTPLEDLEDFLRVEEFALVTDSERKFVLGVATRSDLEMIDVGRLDLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.71
3 0.75
4 0.79
5 0.79
6 0.8
7 0.82
8 0.85
9 0.88
10 0.84
11 0.84
12 0.82
13 0.77
14 0.69
15 0.6
16 0.54
17 0.47
18 0.4
19 0.31
20 0.22
21 0.18
22 0.15
23 0.14
24 0.1
25 0.08
26 0.09
27 0.09
28 0.16
29 0.18
30 0.18
31 0.19
32 0.22
33 0.23
34 0.22
35 0.21
36 0.14
37 0.12
38 0.14
39 0.14
40 0.13
41 0.13
42 0.13
43 0.15
44 0.15
45 0.14
46 0.15
47 0.16
48 0.14
49 0.15
50 0.16
51 0.14
52 0.15
53 0.15
54 0.13
55 0.11
56 0.11
57 0.08
58 0.08
59 0.09
60 0.08
61 0.1
62 0.11
63 0.11
64 0.11
65 0.11
66 0.11
67 0.15
68 0.16
69 0.16
70 0.19
71 0.2
72 0.21
73 0.28
74 0.27
75 0.23
76 0.22
77 0.21
78 0.16
79 0.14
80 0.14
81 0.08
82 0.1
83 0.1
84 0.11
85 0.11
86 0.11
87 0.12
88 0.13
89 0.17
90 0.24
91 0.32
92 0.36
93 0.39
94 0.41
95 0.44
96 0.46
97 0.47
98 0.4
99 0.37
100 0.36
101 0.34
102 0.33
103 0.29
104 0.27
105 0.21
106 0.19
107 0.14
108 0.12
109 0.1
110 0.1
111 0.1
112 0.07
113 0.08
114 0.07
115 0.07
116 0.06
117 0.07
118 0.07
119 0.08
120 0.15
121 0.15
122 0.15
123 0.16
124 0.15
125 0.14
126 0.15
127 0.2
128 0.2
129 0.22
130 0.24
131 0.27
132 0.27
133 0.27
134 0.26
135 0.2
136 0.15
137 0.15
138 0.12
139 0.1
140 0.1