Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167IG85

Protein Details
Accession A0A167IG85   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
177-198SVLMTRWRTRMRRRMNEQDTVTHydrophilic
748-773GTPDQGKDKEPRRKRLSSQNIGRMVRHydrophilic
NLS Segment(s)
PositionSequence
755-804DKEPRRKRLSSQNIGRMVRRISMGARKASTSGSGDGAKSPIEEGKKKGKK
Subcellular Location(s) plas 13, mito 6, E.R. 5, cyto 1, extr 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR003593  AAA+_ATPase  
IPR011527  ABC1_TM_dom  
IPR036640  ABC1_TM_sf  
IPR003439  ABC_transporter-like_ATP-bd  
IPR017871  ABC_transporter-like_CS  
IPR027417  P-loop_NTPase  
IPR039421  Type_1_exporter  
Gene Ontology GO:0016020  C:membrane  
GO:0140359  F:ABC-type transporter activity  
GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
Pfam View protein in Pfam  
PF00664  ABC_membrane  
PF00005  ABC_tran  
PROSITE View protein in PROSITE  
PS50929  ABC_TM1F  
PS00211  ABC_TRANSPORTER_1  
PS50893  ABC_TRANSPORTER_2  
CDD cd18583  ABC_6TM_HMT1  
cd03253  ABCC_ATM1_transporter  
Amino Acid Sequences MTRRLWKLVPYLWPARVWYLQLLAAICIVLLLLGRVVNVLMPITLAQLIDALTYGTSPWLPLARFVGLRFIQSGVLDNVRSALWLPVMQYSDREMSFLSFDHLMNLSLSFHNKRKLGEVTRILNRGSSVNTLFEVLLYMVIPTILDLGIAVIYILFFFGADIAAILACVMCMYAILSVLMTRWRTRMRRRMNEQDTVTRGIHTDCLMNYETVKYFTGEEHEGNRYRESVVKYQSLEYKVYRKSPLAATLTSFLQTVIITLGMTLGSLIIVRRITLGQATQALFVVFITYLSQLTGPLMSLGAIYRHLNQMLVDAEKLLQLLAESVDVQDKPGAAPLIVDDGVIEFENVSFSYDDRRGMSAVKDISFTIPKGKHVALVGESGSGKSTIMRLLFRFYDLKEGEGRILIDGKDIRDVTQKSLRRNIGVVPQDSVLFNETIGFNIGYGKFDASEEEIETAARAAQMHERIMSFPDQYQTKVGERGVKLSGGEKQRVAIARTLLKDPPILLLDEATSALDTATERDIQKALNNLVKGRSSLTIAHRLSTIANADIILVLKDGQIIERGSHRELLKMNGAFAQMWAEHIMAEGETYVPVPSTSAGTPIPGSKAPSVHAEGYLIGDKPGDAAAEAAAAGDVTEVTADKEEGVVPTAPADSGNTGEAAGEPADEPAKPTSYAAAAAAPPAADAPIAFPKASVEDVSVPAATSPTPIQTAAAIAFPSSGGDSTDGTRTPITGPQSVTFSPASTSRPGTPDQGKDKEPRRKRLSSQNIGRMVRRISMGARKASTSGSGDGAKSPIEEGKKKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.46
3 0.42
4 0.37
5 0.31
6 0.27
7 0.25
8 0.26
9 0.24
10 0.19
11 0.17
12 0.14
13 0.11
14 0.09
15 0.07
16 0.04
17 0.04
18 0.04
19 0.04
20 0.05
21 0.05
22 0.05
23 0.05
24 0.06
25 0.06
26 0.06
27 0.05
28 0.06
29 0.06
30 0.07
31 0.08
32 0.08
33 0.07
34 0.07
35 0.08
36 0.07
37 0.07
38 0.06
39 0.05
40 0.05
41 0.06
42 0.06
43 0.06
44 0.07
45 0.09
46 0.13
47 0.13
48 0.16
49 0.19
50 0.21
51 0.23
52 0.23
53 0.29
54 0.26
55 0.27
56 0.26
57 0.24
58 0.21
59 0.2
60 0.23
61 0.17
62 0.19
63 0.18
64 0.16
65 0.17
66 0.15
67 0.15
68 0.13
69 0.11
70 0.1
71 0.11
72 0.12
73 0.15
74 0.17
75 0.17
76 0.18
77 0.2
78 0.22
79 0.21
80 0.21
81 0.17
82 0.17
83 0.17
84 0.16
85 0.16
86 0.14
87 0.14
88 0.15
89 0.16
90 0.15
91 0.14
92 0.14
93 0.14
94 0.13
95 0.19
96 0.22
97 0.27
98 0.33
99 0.35
100 0.36
101 0.4
102 0.47
103 0.47
104 0.51
105 0.54
106 0.54
107 0.59
108 0.6
109 0.54
110 0.46
111 0.41
112 0.34
113 0.28
114 0.25
115 0.2
116 0.19
117 0.19
118 0.19
119 0.17
120 0.15
121 0.14
122 0.1
123 0.08
124 0.07
125 0.06
126 0.05
127 0.05
128 0.05
129 0.04
130 0.05
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.03
139 0.03
140 0.03
141 0.03
142 0.02
143 0.02
144 0.03
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.02
157 0.02
158 0.02
159 0.03
160 0.03
161 0.04
162 0.04
163 0.04
164 0.04
165 0.05
166 0.09
167 0.11
168 0.12
169 0.17
170 0.25
171 0.34
172 0.44
173 0.54
174 0.61
175 0.7
176 0.78
177 0.84
178 0.83
179 0.82
180 0.77
181 0.73
182 0.66
183 0.59
184 0.51
185 0.4
186 0.34
187 0.26
188 0.24
189 0.17
190 0.16
191 0.12
192 0.15
193 0.15
194 0.15
195 0.15
196 0.15
197 0.16
198 0.15
199 0.16
200 0.13
201 0.13
202 0.13
203 0.16
204 0.16
205 0.17
206 0.19
207 0.24
208 0.27
209 0.28
210 0.28
211 0.25
212 0.24
213 0.27
214 0.29
215 0.3
216 0.3
217 0.33
218 0.33
219 0.35
220 0.39
221 0.37
222 0.35
223 0.32
224 0.34
225 0.34
226 0.38
227 0.38
228 0.34
229 0.35
230 0.34
231 0.38
232 0.34
233 0.31
234 0.28
235 0.26
236 0.26
237 0.23
238 0.2
239 0.13
240 0.1
241 0.09
242 0.08
243 0.06
244 0.05
245 0.05
246 0.04
247 0.05
248 0.04
249 0.04
250 0.03
251 0.03
252 0.03
253 0.03
254 0.03
255 0.05
256 0.05
257 0.06
258 0.07
259 0.07
260 0.08
261 0.08
262 0.09
263 0.08
264 0.12
265 0.12
266 0.12
267 0.12
268 0.11
269 0.1
270 0.09
271 0.08
272 0.05
273 0.04
274 0.05
275 0.05
276 0.05
277 0.06
278 0.06
279 0.05
280 0.06
281 0.06
282 0.05
283 0.04
284 0.04
285 0.04
286 0.04
287 0.04
288 0.05
289 0.06
290 0.07
291 0.08
292 0.1
293 0.1
294 0.1
295 0.1
296 0.11
297 0.11
298 0.11
299 0.09
300 0.08
301 0.08
302 0.08
303 0.08
304 0.06
305 0.04
306 0.04
307 0.04
308 0.04
309 0.04
310 0.04
311 0.04
312 0.06
313 0.06
314 0.07
315 0.07
316 0.07
317 0.07
318 0.08
319 0.08
320 0.06
321 0.06
322 0.06
323 0.08
324 0.08
325 0.08
326 0.06
327 0.06
328 0.06
329 0.06
330 0.06
331 0.03
332 0.03
333 0.04
334 0.04
335 0.05
336 0.05
337 0.05
338 0.09
339 0.11
340 0.12
341 0.12
342 0.13
343 0.12
344 0.13
345 0.14
346 0.14
347 0.15
348 0.14
349 0.14
350 0.13
351 0.15
352 0.15
353 0.14
354 0.17
355 0.16
356 0.17
357 0.19
358 0.19
359 0.19
360 0.18
361 0.19
362 0.13
363 0.14
364 0.13
365 0.11
366 0.11
367 0.09
368 0.09
369 0.07
370 0.06
371 0.05
372 0.06
373 0.07
374 0.08
375 0.1
376 0.1
377 0.12
378 0.12
379 0.14
380 0.15
381 0.13
382 0.19
383 0.18
384 0.19
385 0.17
386 0.18
387 0.16
388 0.15
389 0.15
390 0.08
391 0.09
392 0.08
393 0.08
394 0.09
395 0.09
396 0.11
397 0.11
398 0.11
399 0.16
400 0.17
401 0.19
402 0.26
403 0.3
404 0.31
405 0.38
406 0.38
407 0.34
408 0.34
409 0.32
410 0.31
411 0.32
412 0.29
413 0.22
414 0.21
415 0.21
416 0.2
417 0.18
418 0.12
419 0.08
420 0.07
421 0.07
422 0.07
423 0.06
424 0.07
425 0.07
426 0.05
427 0.08
428 0.08
429 0.08
430 0.08
431 0.08
432 0.07
433 0.07
434 0.08
435 0.07
436 0.08
437 0.08
438 0.08
439 0.08
440 0.07
441 0.07
442 0.07
443 0.05
444 0.05
445 0.05
446 0.05
447 0.08
448 0.1
449 0.11
450 0.12
451 0.12
452 0.12
453 0.13
454 0.14
455 0.11
456 0.11
457 0.14
458 0.14
459 0.15
460 0.16
461 0.17
462 0.17
463 0.19
464 0.2
465 0.22
466 0.22
467 0.24
468 0.23
469 0.21
470 0.2
471 0.19
472 0.23
473 0.21
474 0.22
475 0.19
476 0.19
477 0.21
478 0.23
479 0.23
480 0.2
481 0.19
482 0.21
483 0.23
484 0.25
485 0.23
486 0.21
487 0.2
488 0.18
489 0.17
490 0.14
491 0.12
492 0.1
493 0.09
494 0.09
495 0.09
496 0.08
497 0.06
498 0.05
499 0.04
500 0.04
501 0.04
502 0.04
503 0.05
504 0.06
505 0.1
506 0.1
507 0.11
508 0.12
509 0.12
510 0.14
511 0.17
512 0.19
513 0.2
514 0.2
515 0.21
516 0.22
517 0.23
518 0.21
519 0.19
520 0.17
521 0.15
522 0.19
523 0.21
524 0.28
525 0.28
526 0.28
527 0.26
528 0.26
529 0.24
530 0.21
531 0.18
532 0.09
533 0.09
534 0.08
535 0.08
536 0.08
537 0.08
538 0.06
539 0.05
540 0.05
541 0.05
542 0.05
543 0.05
544 0.05
545 0.08
546 0.08
547 0.09
548 0.13
549 0.16
550 0.17
551 0.22
552 0.22
553 0.23
554 0.24
555 0.26
556 0.29
557 0.26
558 0.25
559 0.22
560 0.23
561 0.19
562 0.18
563 0.16
564 0.1
565 0.1
566 0.11
567 0.09
568 0.08
569 0.08
570 0.08
571 0.06
572 0.06
573 0.05
574 0.04
575 0.04
576 0.05
577 0.05
578 0.05
579 0.05
580 0.05
581 0.06
582 0.08
583 0.08
584 0.1
585 0.1
586 0.11
587 0.12
588 0.13
589 0.15
590 0.14
591 0.17
592 0.17
593 0.18
594 0.19
595 0.22
596 0.24
597 0.22
598 0.21
599 0.19
600 0.17
601 0.18
602 0.18
603 0.14
604 0.11
605 0.1
606 0.09
607 0.09
608 0.09
609 0.07
610 0.05
611 0.05
612 0.05
613 0.05
614 0.05
615 0.04
616 0.04
617 0.03
618 0.03
619 0.03
620 0.03
621 0.02
622 0.03
623 0.03
624 0.04
625 0.05
626 0.05
627 0.05
628 0.06
629 0.07
630 0.07
631 0.1
632 0.09
633 0.09
634 0.09
635 0.1
636 0.09
637 0.09
638 0.09
639 0.08
640 0.09
641 0.09
642 0.08
643 0.08
644 0.08
645 0.08
646 0.08
647 0.07
648 0.07
649 0.06
650 0.07
651 0.08
652 0.08
653 0.1
654 0.11
655 0.13
656 0.13
657 0.13
658 0.14
659 0.14
660 0.15
661 0.14
662 0.14
663 0.12
664 0.12
665 0.12
666 0.1
667 0.09
668 0.08
669 0.07
670 0.05
671 0.05
672 0.08
673 0.13
674 0.14
675 0.14
676 0.14
677 0.15
678 0.17
679 0.19
680 0.16
681 0.13
682 0.14
683 0.16
684 0.17
685 0.16
686 0.14
687 0.13
688 0.13
689 0.11
690 0.1
691 0.1
692 0.11
693 0.12
694 0.12
695 0.12
696 0.12
697 0.14
698 0.12
699 0.13
700 0.11
701 0.09
702 0.09
703 0.09
704 0.09
705 0.08
706 0.07
707 0.07
708 0.08
709 0.1
710 0.12
711 0.15
712 0.15
713 0.16
714 0.16
715 0.16
716 0.17
717 0.21
718 0.23
719 0.24
720 0.27
721 0.27
722 0.31
723 0.3
724 0.32
725 0.27
726 0.24
727 0.21
728 0.21
729 0.23
730 0.22
731 0.25
732 0.26
733 0.29
734 0.31
735 0.36
736 0.41
737 0.46
738 0.51
739 0.53
740 0.54
741 0.6
742 0.68
743 0.72
744 0.74
745 0.76
746 0.76
747 0.79
748 0.82
749 0.84
750 0.85
751 0.85
752 0.86
753 0.84
754 0.85
755 0.79
756 0.74
757 0.68
758 0.6
759 0.52
760 0.43
761 0.36
762 0.34
763 0.4
764 0.43
765 0.44
766 0.44
767 0.42
768 0.42
769 0.41
770 0.38
771 0.32
772 0.28
773 0.25
774 0.26
775 0.25
776 0.25
777 0.25
778 0.21
779 0.18
780 0.18
781 0.2
782 0.25
783 0.29
784 0.34