Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167KJ59

Protein Details
Accession A0A167KJ59    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
8-35LSGNNVPHSKHKTKRKWYPNVQNKRLFSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 7, cyto 7, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR034704  L28p-like  
IPR026569  Ribo_L28/L24  
IPR037147  Ribo_L28/L24_sf  
IPR001383  Ribosomal_L28  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00830  Ribosomal_L28  
Amino Acid Sequences LFEGRATLSGNNVPHSKHKTKRKWYPNVQNKRLFSEALGGTVKVRLTTSTLRTIDKYGGLDAYMLRSKNLGAFERMAGSAMGLRIRIREAEQAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.39
3 0.45
4 0.49
5 0.59
6 0.66
7 0.75
8 0.83
9 0.86
10 0.88
11 0.9
12 0.92
13 0.92
14 0.92
15 0.9
16 0.87
17 0.79
18 0.73
19 0.64
20 0.53
21 0.42
22 0.37
23 0.28
24 0.23
25 0.21
26 0.15
27 0.14
28 0.15
29 0.14
30 0.09
31 0.09
32 0.06
33 0.09
34 0.12
35 0.15
36 0.2
37 0.22
38 0.22
39 0.23
40 0.24
41 0.22
42 0.21
43 0.19
44 0.13
45 0.11
46 0.1
47 0.1
48 0.08
49 0.11
50 0.12
51 0.12
52 0.11
53 0.12
54 0.12
55 0.14
56 0.18
57 0.17
58 0.16
59 0.18
60 0.18
61 0.2
62 0.2
63 0.17
64 0.13
65 0.12
66 0.11
67 0.11
68 0.11
69 0.1
70 0.11
71 0.12
72 0.13
73 0.15
74 0.16