Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167QYY9

Protein Details
Accession A0A167QYY9   
Localization Confidence High
Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
92-112AQGIDKPKAKRRPKAKLKEGABasic
154-176LTVPPKPKKSTAKKDEKPKETVKBasic
NLS Segment(s)
PositionSequence
97-124KPKAKRRPKAKLKEGAIVMKDGKKKKRV
158-200PKPKKSTAKKDEKPKETVKEEVSKPKPKSKPTATSGGKKGGGK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.833, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019038  POLD3  
Gene Ontology GO:0043625  C:delta DNA polymerase complex  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF09507  CDC27  
Amino Acid Sequences MPKSKQRLPVKQEDEAEEDDDAPIRPGGRKTNGKSQRAKSAKEATLAAMFYESSDVDMQPAPSPEPVPKEEIEEISKDDMEAEDDEMNESEAQGIDKPKAKRRPKAKLKEGAIVMKDGKKKKRVVKSEMTTNDRGYMVMEDHSEYETVSESEELTVPPKPKKSTAKKDEKPKETVKEEVSKPKPKSKPTATSGGKKGGGKLMDYFNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.53
3 0.46
4 0.36
5 0.3
6 0.23
7 0.2
8 0.16
9 0.13
10 0.12
11 0.11
12 0.14
13 0.17
14 0.24
15 0.32
16 0.41
17 0.45
18 0.55
19 0.63
20 0.68
21 0.74
22 0.71
23 0.74
24 0.7
25 0.68
26 0.65
27 0.65
28 0.6
29 0.53
30 0.49
31 0.4
32 0.37
33 0.33
34 0.25
35 0.16
36 0.13
37 0.1
38 0.1
39 0.08
40 0.07
41 0.08
42 0.08
43 0.08
44 0.09
45 0.1
46 0.11
47 0.12
48 0.11
49 0.12
50 0.13
51 0.14
52 0.17
53 0.18
54 0.2
55 0.19
56 0.22
57 0.23
58 0.24
59 0.23
60 0.2
61 0.2
62 0.18
63 0.17
64 0.13
65 0.12
66 0.09
67 0.09
68 0.08
69 0.08
70 0.07
71 0.08
72 0.08
73 0.08
74 0.09
75 0.07
76 0.06
77 0.05
78 0.05
79 0.05
80 0.06
81 0.07
82 0.09
83 0.15
84 0.18
85 0.26
86 0.37
87 0.44
88 0.5
89 0.59
90 0.68
91 0.73
92 0.8
93 0.81
94 0.79
95 0.75
96 0.73
97 0.65
98 0.57
99 0.47
100 0.39
101 0.31
102 0.27
103 0.3
104 0.3
105 0.34
106 0.38
107 0.44
108 0.51
109 0.59
110 0.63
111 0.65
112 0.69
113 0.68
114 0.71
115 0.71
116 0.68
117 0.6
118 0.52
119 0.47
120 0.36
121 0.31
122 0.22
123 0.16
124 0.11
125 0.1
126 0.1
127 0.09
128 0.09
129 0.1
130 0.09
131 0.08
132 0.08
133 0.08
134 0.07
135 0.07
136 0.07
137 0.06
138 0.07
139 0.08
140 0.08
141 0.08
142 0.12
143 0.16
144 0.2
145 0.26
146 0.28
147 0.36
148 0.46
149 0.56
150 0.63
151 0.7
152 0.77
153 0.79
154 0.88
155 0.9
156 0.86
157 0.82
158 0.79
159 0.77
160 0.7
161 0.68
162 0.63
163 0.61
164 0.6
165 0.63
166 0.64
167 0.65
168 0.66
169 0.7
170 0.72
171 0.71
172 0.75
173 0.75
174 0.75
175 0.71
176 0.77
177 0.74
178 0.75
179 0.72
180 0.69
181 0.65
182 0.57
183 0.54
184 0.5
185 0.44
186 0.37
187 0.36
188 0.38