Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167GVG0

Protein Details
Accession A0A167GVG0    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
140-162AWRAKLRREIKEEKGKREKERGVBasic
NLS Segment(s)
PositionSequence
142-160RAKLRREIKEEKGKREKER
Subcellular Location(s) nucl 11, cyto 7, mito 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011400  EIF3B  
IPR013979  TIF_beta_prop-like  
Gene Ontology GO:0005852  C:eukaryotic translation initiation factor 3 complex  
GO:0003723  F:RNA binding  
GO:0003743  F:translation initiation factor activity  
GO:0031369  F:translation initiation factor binding  
Pfam View protein in Pfam  
PF08662  eIF2A  
Amino Acid Sequences MALDFTGKDASRATGSEKDPGAGIQLLDTTEHYDVTDIEWDLSGRYLTSRASAWRHTLKNGYTIWDFRRQELTKQVLDRFKQFLWRPRPRTLLSKEQQREIHKRLREHSKQFDEEDAVEESTVSAELIAARRWLIEEWNAWRAKLRREIKEEKGKREKERGVAQEKIEQGVCG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.31
4 0.3
5 0.28
6 0.27
7 0.26
8 0.23
9 0.17
10 0.15
11 0.1
12 0.1
13 0.1
14 0.1
15 0.11
16 0.11
17 0.1
18 0.1
19 0.1
20 0.1
21 0.09
22 0.1
23 0.13
24 0.1
25 0.1
26 0.1
27 0.1
28 0.1
29 0.1
30 0.09
31 0.06
32 0.07
33 0.07
34 0.07
35 0.09
36 0.1
37 0.14
38 0.17
39 0.2
40 0.25
41 0.32
42 0.33
43 0.34
44 0.38
45 0.34
46 0.36
47 0.34
48 0.32
49 0.26
50 0.28
51 0.28
52 0.33
53 0.32
54 0.29
55 0.37
56 0.35
57 0.36
58 0.4
59 0.41
60 0.35
61 0.38
62 0.41
63 0.37
64 0.37
65 0.37
66 0.33
67 0.28
68 0.33
69 0.33
70 0.37
71 0.42
72 0.5
73 0.53
74 0.54
75 0.6
76 0.55
77 0.59
78 0.56
79 0.56
80 0.52
81 0.57
82 0.53
83 0.54
84 0.56
85 0.55
86 0.57
87 0.52
88 0.54
89 0.49
90 0.51
91 0.53
92 0.58
93 0.6
94 0.6
95 0.64
96 0.62
97 0.61
98 0.58
99 0.53
100 0.44
101 0.36
102 0.31
103 0.23
104 0.16
105 0.13
106 0.12
107 0.1
108 0.08
109 0.08
110 0.05
111 0.03
112 0.03
113 0.05
114 0.06
115 0.07
116 0.08
117 0.07
118 0.08
119 0.09
120 0.1
121 0.1
122 0.12
123 0.16
124 0.2
125 0.27
126 0.28
127 0.27
128 0.33
129 0.35
130 0.39
131 0.45
132 0.49
133 0.5
134 0.59
135 0.67
136 0.7
137 0.77
138 0.78
139 0.78
140 0.8
141 0.8
142 0.79
143 0.81
144 0.78
145 0.75
146 0.77
147 0.76
148 0.72
149 0.7
150 0.64
151 0.61
152 0.56
153 0.51