Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167IBM2

Protein Details
Accession A0A167IBM2    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
34-60RTSHEYRRTGRRRGHTRHHRSAKRAGVBasic
NLS Segment(s)
PositionSequence
40-66RRTGRRRGHTRHHRSAKRAGVQTKPPP
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MAALERQSPRLNVNRAPAVCPKSSLFSHSHTHPRTSHEYRRTGRRRGHTRHHRSAKRAGVQTKPPPHKTGSHVSPLLRNSFHPTRQHRWRSAASPCFPPIPSYPRAAPVSCSHCDCTTRSLNQYCGWPAYVTTRSRRRRPTETFDLRKGRQRMRVPSHHHPSVLRSMPQPLPCLKTGAAAFSLSPLLQILLLARCRPCSPPLMSDDPALPCRPPTPKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.5
3 0.52
4 0.54
5 0.5
6 0.45
7 0.43
8 0.38
9 0.34
10 0.34
11 0.34
12 0.3
13 0.29
14 0.33
15 0.36
16 0.45
17 0.42
18 0.47
19 0.44
20 0.47
21 0.52
22 0.56
23 0.6
24 0.58
25 0.65
26 0.66
27 0.74
28 0.76
29 0.75
30 0.75
31 0.76
32 0.78
33 0.78
34 0.83
35 0.83
36 0.85
37 0.88
38 0.9
39 0.86
40 0.82
41 0.82
42 0.79
43 0.76
44 0.73
45 0.67
46 0.63
47 0.64
48 0.68
49 0.69
50 0.68
51 0.64
52 0.59
53 0.57
54 0.55
55 0.52
56 0.52
57 0.46
58 0.44
59 0.44
60 0.42
61 0.43
62 0.4
63 0.38
64 0.3
65 0.26
66 0.27
67 0.29
68 0.33
69 0.37
70 0.42
71 0.48
72 0.57
73 0.64
74 0.61
75 0.62
76 0.61
77 0.58
78 0.59
79 0.58
80 0.5
81 0.46
82 0.42
83 0.39
84 0.35
85 0.32
86 0.27
87 0.24
88 0.24
89 0.23
90 0.22
91 0.25
92 0.27
93 0.24
94 0.24
95 0.23
96 0.26
97 0.25
98 0.26
99 0.23
100 0.22
101 0.23
102 0.22
103 0.23
104 0.22
105 0.23
106 0.27
107 0.27
108 0.28
109 0.28
110 0.3
111 0.25
112 0.22
113 0.2
114 0.15
115 0.13
116 0.16
117 0.2
118 0.21
119 0.28
120 0.37
121 0.44
122 0.52
123 0.61
124 0.63
125 0.67
126 0.72
127 0.73
128 0.74
129 0.76
130 0.75
131 0.74
132 0.74
133 0.68
134 0.68
135 0.66
136 0.62
137 0.6
138 0.62
139 0.64
140 0.65
141 0.72
142 0.72
143 0.75
144 0.77
145 0.7
146 0.64
147 0.56
148 0.51
149 0.5
150 0.45
151 0.37
152 0.31
153 0.34
154 0.37
155 0.38
156 0.37
157 0.32
158 0.33
159 0.31
160 0.33
161 0.27
162 0.27
163 0.25
164 0.24
165 0.21
166 0.18
167 0.17
168 0.15
169 0.15
170 0.1
171 0.1
172 0.08
173 0.07
174 0.06
175 0.07
176 0.08
177 0.11
178 0.14
179 0.17
180 0.18
181 0.2
182 0.22
183 0.25
184 0.26
185 0.28
186 0.31
187 0.33
188 0.38
189 0.43
190 0.43
191 0.41
192 0.42
193 0.4
194 0.39
195 0.36
196 0.3
197 0.25
198 0.29