Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167S6E1

Protein Details
Accession A0A167S6E1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGRKRRPLRTIRVLPRKAKGBasic
NLS Segment(s)
PositionSequence
3-19RKRRPLRTIRVLPRKAK
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MGRKRRPLRTIRVLPRKAKGNTRQVWIVASAHSDGCRRYDVMHAPSEIIIAGWCVTVASSGQRELAVSCRIEQCCLYSRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.78
4 0.72
5 0.71
6 0.69
7 0.69
8 0.66
9 0.64
10 0.6
11 0.52
12 0.48
13 0.39
14 0.31
15 0.21
16 0.17
17 0.13
18 0.11
19 0.12
20 0.12
21 0.11
22 0.11
23 0.12
24 0.11
25 0.11
26 0.15
27 0.18
28 0.2
29 0.21
30 0.2
31 0.19
32 0.19
33 0.18
34 0.14
35 0.09
36 0.06
37 0.04
38 0.04
39 0.04
40 0.04
41 0.03
42 0.03
43 0.04
44 0.04
45 0.07
46 0.08
47 0.09
48 0.1
49 0.1
50 0.1
51 0.11
52 0.15
53 0.16
54 0.16
55 0.18
56 0.24
57 0.25
58 0.27
59 0.27
60 0.27