Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167FN16

Protein Details
Accession A0A167FN16   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
51-76PSQRHSPTTHPAKKHRPRLLPCRSSLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 4.5, mito 2, plas 2
Family & Domain DBs
Amino Acid Sequences MISVFGQLSGNGLGNLNNNVMYNILGYIPPAVQLALNLGPADRTLSPPLVPSQRHSPTTHPAKKHRPRLLPCRSSLPAPQTVLIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.12
4 0.11
5 0.11
6 0.1
7 0.11
8 0.1
9 0.08
10 0.07
11 0.07
12 0.06
13 0.06
14 0.06
15 0.06
16 0.06
17 0.06
18 0.06
19 0.05
20 0.05
21 0.07
22 0.07
23 0.07
24 0.06
25 0.06
26 0.06
27 0.06
28 0.08
29 0.06
30 0.08
31 0.09
32 0.1
33 0.1
34 0.11
35 0.14
36 0.17
37 0.18
38 0.2
39 0.27
40 0.31
41 0.34
42 0.35
43 0.37
44 0.41
45 0.51
46 0.55
47 0.53
48 0.58
49 0.66
50 0.74
51 0.8
52 0.8
53 0.79
54 0.81
55 0.85
56 0.87
57 0.83
58 0.76
59 0.74
60 0.67
61 0.61
62 0.58
63 0.54
64 0.49
65 0.44