Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167GXS2

Protein Details
Accession A0A167GXS2    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
32-62EIKRKGRPQTQCERCRERRKKDRSHVRCNCSBasic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001083  Cu_fist_DNA-bd_dom  
IPR036395  Cu_fist_DNA-bd_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0005507  F:copper ion binding  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00649  Copper-fist  
PROSITE View protein in PROSITE  
PS50073  COPPER_FIST_2  
Amino Acid Sequences QVFINDKKYACATCIKGHRSSACLHSTRSLFEIKRKGRPQTQCERCRERRKKDRSHVRCNCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.42
3 0.42
4 0.46
5 0.45
6 0.41
7 0.39
8 0.37
9 0.34
10 0.32
11 0.3
12 0.29
13 0.28
14 0.27
15 0.26
16 0.25
17 0.2
18 0.25
19 0.33
20 0.32
21 0.41
22 0.45
23 0.49
24 0.53
25 0.61
26 0.63
27 0.65
28 0.72
29 0.71
30 0.75
31 0.79
32 0.81
33 0.83
34 0.86
35 0.86
36 0.86
37 0.88
38 0.91
39 0.92
40 0.93
41 0.92
42 0.93