Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167LAN7

Protein Details
Accession A0A167LAN7    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
91-132GNEYQPSQRKRKRKFGFLQRLRSKNGRKTLAARRWKGRRYLSHydrophilic
NLS Segment(s)
PositionSequence
99-129RKRKRKFGFLQRLRSKNGRKTLAARRWKGRR
Subcellular Location(s) mito 12, nucl 11, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRHLIRRAITAAARTATRPAAPTTTAVSAVALVRPSSSRIGTSTLPSPFRTLTPFSPRPSALTTLSPVRPSIALSPLTAALPLLQARFLGNEYQPSQRKRKRKFGFLQRLRSKNGRKTLAARRWKGRRYLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.25
3 0.24
4 0.22
5 0.21
6 0.21
7 0.2
8 0.21
9 0.21
10 0.21
11 0.22
12 0.21
13 0.2
14 0.18
15 0.15
16 0.13
17 0.13
18 0.12
19 0.1
20 0.08
21 0.08
22 0.09
23 0.11
24 0.12
25 0.13
26 0.12
27 0.13
28 0.17
29 0.17
30 0.19
31 0.21
32 0.22
33 0.24
34 0.24
35 0.24
36 0.22
37 0.21
38 0.22
39 0.21
40 0.22
41 0.29
42 0.33
43 0.33
44 0.35
45 0.34
46 0.34
47 0.33
48 0.31
49 0.23
50 0.2
51 0.2
52 0.2
53 0.21
54 0.19
55 0.17
56 0.15
57 0.13
58 0.13
59 0.12
60 0.12
61 0.12
62 0.11
63 0.12
64 0.12
65 0.11
66 0.1
67 0.08
68 0.06
69 0.06
70 0.07
71 0.06
72 0.06
73 0.06
74 0.06
75 0.07
76 0.08
77 0.09
78 0.09
79 0.13
80 0.16
81 0.24
82 0.3
83 0.34
84 0.44
85 0.5
86 0.6
87 0.65
88 0.74
89 0.74
90 0.79
91 0.84
92 0.84
93 0.88
94 0.87
95 0.89
96 0.88
97 0.85
98 0.8
99 0.79
100 0.77
101 0.74
102 0.74
103 0.69
104 0.65
105 0.68
106 0.73
107 0.73
108 0.75
109 0.73
110 0.74
111 0.78
112 0.8
113 0.81