Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167G554

Protein Details
Accession A0A167G554    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
35-59DTPVSSSSTPRKRANRKNQAVPLDAHydrophilic
108-130RPLSPRPTERRQRPTLCRSRRPTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26
Family & Domain DBs
Amino Acid Sequences MLEQAQKTYDAEDLPDVEDAFLAPIQSYHHVEPLDTPVSSSSTPRKRANRKNQAVPLDAVIQEEIFRGNSCMLSTEPKAIGQLSTPDPYLPVRPSDDRGPPSVVLDVRPLSPRPTERRQRPTLCRSRRPTPVRCPSPASIYEIEAPHRSRPSPPITPIFGGGQPFMKSFQTSMRALCKGAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.15
4 0.12
5 0.12
6 0.1
7 0.09
8 0.08
9 0.07
10 0.06
11 0.06
12 0.09
13 0.13
14 0.16
15 0.16
16 0.2
17 0.2
18 0.2
19 0.21
20 0.24
21 0.23
22 0.19
23 0.18
24 0.15
25 0.18
26 0.18
27 0.2
28 0.24
29 0.3
30 0.37
31 0.45
32 0.54
33 0.62
34 0.73
35 0.81
36 0.83
37 0.83
38 0.86
39 0.85
40 0.8
41 0.72
42 0.62
43 0.52
44 0.43
45 0.35
46 0.25
47 0.18
48 0.12
49 0.1
50 0.09
51 0.08
52 0.06
53 0.06
54 0.06
55 0.07
56 0.07
57 0.07
58 0.08
59 0.08
60 0.12
61 0.12
62 0.14
63 0.14
64 0.14
65 0.14
66 0.13
67 0.12
68 0.09
69 0.11
70 0.11
71 0.11
72 0.11
73 0.11
74 0.11
75 0.12
76 0.14
77 0.12
78 0.11
79 0.13
80 0.14
81 0.18
82 0.21
83 0.25
84 0.25
85 0.26
86 0.27
87 0.24
88 0.23
89 0.23
90 0.19
91 0.15
92 0.15
93 0.14
94 0.13
95 0.15
96 0.15
97 0.15
98 0.18
99 0.23
100 0.28
101 0.37
102 0.46
103 0.53
104 0.62
105 0.69
106 0.74
107 0.77
108 0.8
109 0.81
110 0.81
111 0.81
112 0.79
113 0.78
114 0.79
115 0.79
116 0.77
117 0.77
118 0.78
119 0.75
120 0.71
121 0.7
122 0.62
123 0.6
124 0.52
125 0.47
126 0.37
127 0.33
128 0.33
129 0.28
130 0.29
131 0.28
132 0.28
133 0.28
134 0.3
135 0.29
136 0.29
137 0.35
138 0.39
139 0.42
140 0.45
141 0.46
142 0.47
143 0.47
144 0.45
145 0.41
146 0.36
147 0.3
148 0.26
149 0.23
150 0.21
151 0.2
152 0.2
153 0.19
154 0.18
155 0.18
156 0.23
157 0.26
158 0.26
159 0.3
160 0.35
161 0.35