Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2X0E0

Protein Details
Accession G2X0E0   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
118-145HLHSEPPPPPRNKKQAKKRQAVDPTPELHydrophilic
NLS Segment(s)
PositionSequence
125-155PPPRNKKQAKKRQAVDPTPELPSAPKTRRKK
Subcellular Location(s) nucl 19, cyto_nucl 12.5, cyto 4, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR028941  WHIM2_dom  
KEGG vda:VDAG_03719  -  
Pfam View protein in Pfam  
PF15613  WSD  
Amino Acid Sequences MTVPERKKMEEGATSVFNAGQWGYYDDPESVDNLIRWLDPRGYNELKLRKEILSFKDKIAKHMENRKEYLAPAEKEEEESKEPKRGVATRTRQQQTAEPTNYRCLAWENTVAMEELGHLHSEPPPPPRNKKQAKKRQAVDPTPELPSAPKTRRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.26
4 0.2
5 0.16
6 0.13
7 0.09
8 0.08
9 0.11
10 0.12
11 0.13
12 0.14
13 0.13
14 0.15
15 0.14
16 0.14
17 0.12
18 0.12
19 0.11
20 0.11
21 0.11
22 0.1
23 0.11
24 0.13
25 0.16
26 0.17
27 0.2
28 0.26
29 0.28
30 0.31
31 0.37
32 0.42
33 0.39
34 0.4
35 0.39
36 0.33
37 0.34
38 0.36
39 0.35
40 0.35
41 0.35
42 0.34
43 0.39
44 0.38
45 0.38
46 0.41
47 0.4
48 0.39
49 0.47
50 0.53
51 0.5
52 0.52
53 0.5
54 0.43
55 0.38
56 0.37
57 0.34
58 0.27
59 0.24
60 0.25
61 0.23
62 0.24
63 0.24
64 0.2
65 0.16
66 0.19
67 0.18
68 0.21
69 0.21
70 0.19
71 0.22
72 0.23
73 0.25
74 0.32
75 0.39
76 0.41
77 0.51
78 0.52
79 0.5
80 0.48
81 0.49
82 0.47
83 0.48
84 0.45
85 0.39
86 0.39
87 0.4
88 0.4
89 0.35
90 0.28
91 0.22
92 0.21
93 0.2
94 0.21
95 0.18
96 0.18
97 0.18
98 0.17
99 0.14
100 0.11
101 0.08
102 0.07
103 0.07
104 0.07
105 0.06
106 0.07
107 0.1
108 0.14
109 0.17
110 0.23
111 0.31
112 0.38
113 0.47
114 0.56
115 0.65
116 0.72
117 0.8
118 0.84
119 0.87
120 0.9
121 0.91
122 0.88
123 0.87
124 0.87
125 0.84
126 0.8
127 0.76
128 0.68
129 0.61
130 0.55
131 0.45
132 0.37
133 0.37
134 0.38
135 0.4