Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167MV11

Protein Details
Accession A0A167MV11    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-31VLCLRGKRTKFRSKIPYRGGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 23, mito 3
Family & Domain DBs
Amino Acid Sequences MPAASFSFWFSVLCLRGKRTKFRSKIPYRGGVSKDSILPGKNDSALTPSDPVPNLAYTNQSTGVCGGDIDTSGDTTAHVVLLPCILSALSSAWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.34
4 0.39
5 0.48
6 0.53
7 0.6
8 0.62
9 0.69
10 0.75
11 0.76
12 0.81
13 0.78
14 0.77
15 0.71
16 0.71
17 0.64
18 0.56
19 0.49
20 0.41
21 0.35
22 0.28
23 0.25
24 0.19
25 0.18
26 0.16
27 0.14
28 0.14
29 0.13
30 0.12
31 0.12
32 0.12
33 0.11
34 0.11
35 0.11
36 0.11
37 0.11
38 0.12
39 0.12
40 0.12
41 0.12
42 0.11
43 0.13
44 0.12
45 0.13
46 0.15
47 0.13
48 0.13
49 0.13
50 0.12
51 0.1
52 0.09
53 0.08
54 0.06
55 0.06
56 0.07
57 0.07
58 0.06
59 0.07
60 0.07
61 0.06
62 0.07
63 0.07
64 0.06
65 0.06
66 0.06
67 0.06
68 0.07
69 0.07
70 0.06
71 0.07
72 0.06
73 0.06
74 0.06