Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167GNW9

Protein Details
Accession A0A167GNW9    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
22-59LLTPAPTPRTPRKRKLAVEEPVTPTKPVKRKRASAAAVHydrophilic
321-347AVPPIPTPETPKKRKKAVKVEVSRDGVHydrophilic
NLS Segment(s)
PositionSequence
32-37PRKRKL
46-53TKPVKRKR
332-337KKRKKA
Subcellular Location(s) mito 18, nucl 4.5, cyto_nucl 4.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011257  DNA_glycosylase  
IPR003265  HhH-GPD_domain  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006285  P:base-excision repair, AP site formation  
Pfam View protein in Pfam  
PF00730  HhH-GPD  
CDD cd00056  ENDO3c  
Amino Acid Sequences MVSTRSAIRVNTAVRETTPVGLLTPAPTPRTPRKRKLAVEEPVTPTKPVKRKRASAAAVPPTPVTPSTVTVAAEITSAPIAVKEFIEEEDILPPVLSFDLEHAKRHIIAADERFHEVFNRLPCKPFEVLDVVHPFRTLATSILGQQISWRAARSITAKFLRIFDPSLPERGDVLPHMADRPFPTPHQLASTSIPTLRGAGLSQRKAEYVIDLASRFADGRLSASLLSKATDEELAESLIAVRGIGPWTVDMFAMFSAHRPDIMPYGDLGVQRGLLRWVLASHDSNYRIEVEPKKLPQPSVEEEPEAAEAIEPAPKEEDGSAVPPIPTPETPKKRKKAVKVEVSRDGVHIPTGTPIKLPTGLTVAQLKSRLAGKKEKKGVYLTPEEMDALTEGWKPYRSIAVWYMWALAEESL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.34
3 0.32
4 0.28
5 0.26
6 0.21
7 0.18
8 0.18
9 0.18
10 0.15
11 0.18
12 0.19
13 0.22
14 0.24
15 0.31
16 0.41
17 0.51
18 0.6
19 0.65
20 0.72
21 0.78
22 0.84
23 0.87
24 0.86
25 0.83
26 0.8
27 0.77
28 0.73
29 0.7
30 0.63
31 0.55
32 0.49
33 0.49
34 0.52
35 0.54
36 0.58
37 0.61
38 0.67
39 0.75
40 0.81
41 0.77
42 0.76
43 0.77
44 0.74
45 0.67
46 0.6
47 0.51
48 0.41
49 0.38
50 0.29
51 0.23
52 0.16
53 0.17
54 0.18
55 0.19
56 0.19
57 0.17
58 0.17
59 0.14
60 0.12
61 0.1
62 0.08
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.07
69 0.07
70 0.07
71 0.08
72 0.09
73 0.12
74 0.12
75 0.11
76 0.12
77 0.12
78 0.11
79 0.1
80 0.1
81 0.07
82 0.07
83 0.06
84 0.05
85 0.07
86 0.16
87 0.17
88 0.19
89 0.2
90 0.22
91 0.22
92 0.23
93 0.22
94 0.16
95 0.21
96 0.24
97 0.27
98 0.28
99 0.29
100 0.29
101 0.27
102 0.25
103 0.22
104 0.21
105 0.23
106 0.27
107 0.26
108 0.29
109 0.29
110 0.33
111 0.32
112 0.28
113 0.24
114 0.22
115 0.22
116 0.25
117 0.3
118 0.27
119 0.25
120 0.25
121 0.21
122 0.18
123 0.18
124 0.13
125 0.08
126 0.09
127 0.09
128 0.11
129 0.15
130 0.14
131 0.13
132 0.13
133 0.16
134 0.16
135 0.15
136 0.15
137 0.11
138 0.12
139 0.15
140 0.17
141 0.16
142 0.22
143 0.23
144 0.25
145 0.26
146 0.28
147 0.26
148 0.24
149 0.24
150 0.18
151 0.22
152 0.2
153 0.22
154 0.21
155 0.2
156 0.19
157 0.18
158 0.18
159 0.12
160 0.13
161 0.11
162 0.11
163 0.12
164 0.1
165 0.11
166 0.12
167 0.15
168 0.15
169 0.14
170 0.19
171 0.18
172 0.19
173 0.21
174 0.2
175 0.19
176 0.19
177 0.2
178 0.16
179 0.16
180 0.16
181 0.13
182 0.12
183 0.1
184 0.08
185 0.07
186 0.12
187 0.18
188 0.19
189 0.2
190 0.2
191 0.2
192 0.2
193 0.2
194 0.14
195 0.1
196 0.09
197 0.09
198 0.09
199 0.09
200 0.08
201 0.08
202 0.07
203 0.06
204 0.06
205 0.05
206 0.06
207 0.06
208 0.07
209 0.07
210 0.08
211 0.09
212 0.08
213 0.09
214 0.08
215 0.07
216 0.07
217 0.08
218 0.07
219 0.07
220 0.07
221 0.07
222 0.06
223 0.06
224 0.06
225 0.05
226 0.05
227 0.04
228 0.03
229 0.04
230 0.05
231 0.05
232 0.05
233 0.05
234 0.06
235 0.06
236 0.06
237 0.05
238 0.05
239 0.05
240 0.06
241 0.06
242 0.06
243 0.09
244 0.09
245 0.09
246 0.09
247 0.1
248 0.12
249 0.13
250 0.13
251 0.1
252 0.12
253 0.14
254 0.13
255 0.13
256 0.1
257 0.11
258 0.1
259 0.11
260 0.1
261 0.08
262 0.08
263 0.07
264 0.08
265 0.09
266 0.11
267 0.13
268 0.14
269 0.18
270 0.2
271 0.2
272 0.21
273 0.21
274 0.2
275 0.25
276 0.28
277 0.28
278 0.33
279 0.36
280 0.41
281 0.41
282 0.4
283 0.38
284 0.39
285 0.39
286 0.41
287 0.39
288 0.34
289 0.32
290 0.32
291 0.28
292 0.22
293 0.16
294 0.09
295 0.07
296 0.07
297 0.08
298 0.07
299 0.08
300 0.09
301 0.09
302 0.1
303 0.1
304 0.11
305 0.1
306 0.13
307 0.13
308 0.13
309 0.13
310 0.13
311 0.15
312 0.16
313 0.16
314 0.23
315 0.32
316 0.41
317 0.51
318 0.61
319 0.67
320 0.75
321 0.82
322 0.85
323 0.85
324 0.86
325 0.86
326 0.86
327 0.85
328 0.83
329 0.79
330 0.69
331 0.59
332 0.5
333 0.39
334 0.3
335 0.23
336 0.15
337 0.16
338 0.18
339 0.17
340 0.16
341 0.17
342 0.18
343 0.21
344 0.21
345 0.17
346 0.19
347 0.2
348 0.22
349 0.26
350 0.25
351 0.25
352 0.27
353 0.25
354 0.24
355 0.29
356 0.33
357 0.33
358 0.42
359 0.48
360 0.56
361 0.66
362 0.67
363 0.65
364 0.65
365 0.66
366 0.63
367 0.62
368 0.55
369 0.46
370 0.43
371 0.39
372 0.33
373 0.27
374 0.2
375 0.12
376 0.11
377 0.13
378 0.13
379 0.15
380 0.18
381 0.18
382 0.19
383 0.26
384 0.25
385 0.28
386 0.31
387 0.32
388 0.33
389 0.33
390 0.32
391 0.25
392 0.25