Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167L254

Protein Details
Accession A0A167L254    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
14-36KIPWRLSAPRKARQRFRLKQVDSHydrophilic
73-93SPKSRGYRKGIHKVPKWTRITHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFPTSPTLSGLLWKIPWRLSAPRKARQRFRLKQVDSVIEAVRASGVETKSLNVALALPKEHEMPARDKYTVFSPKSRGYRKGIHKVPKWTRITQRVNPRGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.25
4 0.26
5 0.34
6 0.39
7 0.47
8 0.52
9 0.58
10 0.67
11 0.73
12 0.78
13 0.79
14 0.82
15 0.8
16 0.82
17 0.84
18 0.76
19 0.74
20 0.69
21 0.62
22 0.52
23 0.46
24 0.36
25 0.26
26 0.23
27 0.16
28 0.12
29 0.08
30 0.07
31 0.08
32 0.08
33 0.09
34 0.09
35 0.1
36 0.1
37 0.1
38 0.09
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.08
45 0.09
46 0.1
47 0.1
48 0.12
49 0.13
50 0.16
51 0.21
52 0.23
53 0.23
54 0.22
55 0.23
56 0.29
57 0.34
58 0.33
59 0.32
60 0.35
61 0.42
62 0.51
63 0.56
64 0.54
65 0.52
66 0.59
67 0.64
68 0.7
69 0.71
70 0.72
71 0.73
72 0.78
73 0.81
74 0.82
75 0.78
76 0.76
77 0.77
78 0.78
79 0.8
80 0.77
81 0.8