Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167L3J9

Protein Details
Accession A0A167L3J9    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGKRKKSSRKPGGGRVKLQPBasic
NLS Segment(s)
PositionSequence
3-15KRKKSSRKPGGGR
Subcellular Location(s) nucl 17.5, cyto_nucl 13, mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPGGGRVKLQPLETTFQCLFCHHNDSVVCKLDKTEGLGQLHCKICGQRFSCTVNYLSEPIDVYSEWIDASEKAQDRRAPVRKQRPVPIEEEDEDEPRARTPLGDEEDYDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.79
3 0.78
4 0.7
5 0.62
6 0.55
7 0.47
8 0.44
9 0.39
10 0.38
11 0.29
12 0.28
13 0.27
14 0.25
15 0.24
16 0.21
17 0.27
18 0.2
19 0.24
20 0.23
21 0.27
22 0.3
23 0.31
24 0.29
25 0.23
26 0.24
27 0.22
28 0.21
29 0.22
30 0.21
31 0.22
32 0.23
33 0.24
34 0.25
35 0.28
36 0.28
37 0.24
38 0.21
39 0.17
40 0.19
41 0.25
42 0.25
43 0.22
44 0.25
45 0.28
46 0.29
47 0.29
48 0.27
49 0.21
50 0.2
51 0.18
52 0.16
53 0.12
54 0.11
55 0.1
56 0.09
57 0.08
58 0.08
59 0.07
60 0.07
61 0.06
62 0.06
63 0.07
64 0.06
65 0.07
66 0.12
67 0.14
68 0.16
69 0.2
70 0.22
71 0.26
72 0.36
73 0.44
74 0.48
75 0.56
76 0.65
77 0.7
78 0.76
79 0.8
80 0.77
81 0.71
82 0.67
83 0.62
84 0.57
85 0.49
86 0.46
87 0.39
88 0.34
89 0.32
90 0.29
91 0.24
92 0.19
93 0.19
94 0.15
95 0.13
96 0.15
97 0.22
98 0.26
99 0.27