Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167GRW6

Protein Details
Accession A0A167GRW6   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
115-145QESKANTRRPQKTVPDKRPQRKSVRTIPYTRHydrophilic
NLS Segment(s)
PositionSequence
129-138PDKRPQRKSV
Subcellular Location(s) nucl 16.5, cyto_nucl 13.333, mito_nucl 9.666, cyto 8
Family & Domain DBs
Amino Acid Sequences MSATPGGETVGLQMKRCLDYRNAMVVQGELLERQEKIAQAVRRNHEVLTRTRTVRGKVILYVPETSGGKERKARTTGALRAEADTVLQKRAHEDAADEDNEEEEDEQTQDKEQEQESKANTRRPQKTVPDKRPQRKSVRTIPYTRSRDAGAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.28
4 0.29
5 0.25
6 0.3
7 0.33
8 0.39
9 0.36
10 0.34
11 0.33
12 0.29
13 0.25
14 0.2
15 0.15
16 0.08
17 0.09
18 0.09
19 0.09
20 0.1
21 0.12
22 0.11
23 0.14
24 0.2
25 0.24
26 0.3
27 0.38
28 0.41
29 0.44
30 0.44
31 0.42
32 0.39
33 0.38
34 0.36
35 0.36
36 0.36
37 0.33
38 0.38
39 0.4
40 0.38
41 0.39
42 0.36
43 0.31
44 0.28
45 0.3
46 0.27
47 0.25
48 0.24
49 0.19
50 0.19
51 0.17
52 0.16
53 0.19
54 0.17
55 0.18
56 0.23
57 0.26
58 0.29
59 0.31
60 0.31
61 0.29
62 0.34
63 0.36
64 0.34
65 0.34
66 0.29
67 0.28
68 0.27
69 0.22
70 0.16
71 0.15
72 0.12
73 0.12
74 0.12
75 0.12
76 0.13
77 0.15
78 0.15
79 0.12
80 0.12
81 0.13
82 0.16
83 0.16
84 0.14
85 0.13
86 0.12
87 0.12
88 0.12
89 0.08
90 0.05
91 0.06
92 0.06
93 0.07
94 0.07
95 0.08
96 0.09
97 0.1
98 0.12
99 0.13
100 0.2
101 0.21
102 0.26
103 0.28
104 0.36
105 0.4
106 0.45
107 0.51
108 0.53
109 0.58
110 0.6
111 0.65
112 0.67
113 0.73
114 0.77
115 0.8
116 0.81
117 0.85
118 0.89
119 0.91
120 0.9
121 0.89
122 0.88
123 0.87
124 0.86
125 0.85
126 0.83
127 0.8
128 0.79
129 0.79
130 0.75
131 0.68
132 0.6
133 0.53