Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2WTM8

Protein Details
Accession G2WTM8    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
70-95HSSVKKRCEHCKIVRRKAGKRHNGYLBasic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 2.5, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG vda:VDAG_01151  -  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MSALSLARSFGALTLTVPRALAATAPTMTKTQTRALTTALFSRPRVGLAETTSKTAVQTIVQQVRGMKVHSSVKKRCEHCKIVRRKAGKRHNGYLYVICKSNPRHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.14
4 0.14
5 0.13
6 0.12
7 0.12
8 0.12
9 0.08
10 0.09
11 0.09
12 0.1
13 0.11
14 0.12
15 0.13
16 0.15
17 0.16
18 0.19
19 0.23
20 0.25
21 0.24
22 0.26
23 0.26
24 0.25
25 0.26
26 0.25
27 0.23
28 0.21
29 0.22
30 0.2
31 0.19
32 0.19
33 0.16
34 0.14
35 0.14
36 0.21
37 0.19
38 0.2
39 0.2
40 0.18
41 0.17
42 0.16
43 0.14
44 0.08
45 0.1
46 0.15
47 0.17
48 0.18
49 0.19
50 0.19
51 0.2
52 0.21
53 0.18
54 0.13
55 0.15
56 0.22
57 0.28
58 0.36
59 0.39
60 0.46
61 0.53
62 0.57
63 0.62
64 0.63
65 0.66
66 0.68
67 0.73
68 0.76
69 0.78
70 0.82
71 0.82
72 0.82
73 0.83
74 0.84
75 0.84
76 0.81
77 0.79
78 0.78
79 0.73
80 0.68
81 0.65
82 0.58
83 0.51
84 0.44
85 0.36
86 0.36
87 0.39
88 0.46
89 0.49
90 0.54