Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167LSJ3

Protein Details
Accession A0A167LSJ3    Localization Confidence High Confidence Score 20.5
NoLS Segment(s)
PositionSequenceProtein Nature
16-38GGDAGGKKKKKSKTKETMKESLLBasic
66-85APTREKKKRDDNKTEAERRFBasic
NLS Segment(s)
PositionSequence
13-36KLKGGDAGGKKKKKSKTKETMKES
71-75KKKRD
83-84RR
90-90R
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MADYDFRPGGSLKLKGGDAGGKKKKKSKTKETMKESLLKGKARESEGLSDEPTSSAVEDVDADADAPTREKKKRDDNKTEAERRFEERQRRMLERKVEQMAKKTHKDRVHEFNAKLETLSEHHDIPKVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.24
4 0.26
5 0.27
6 0.35
7 0.43
8 0.46
9 0.52
10 0.59
11 0.67
12 0.71
13 0.75
14 0.76
15 0.77
16 0.82
17 0.87
18 0.87
19 0.85
20 0.79
21 0.76
22 0.66
23 0.64
24 0.58
25 0.5
26 0.43
27 0.4
28 0.41
29 0.36
30 0.37
31 0.3
32 0.29
33 0.29
34 0.28
35 0.24
36 0.2
37 0.18
38 0.15
39 0.14
40 0.1
41 0.07
42 0.06
43 0.05
44 0.05
45 0.05
46 0.05
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.05
54 0.07
55 0.12
56 0.16
57 0.2
58 0.27
59 0.37
60 0.47
61 0.57
62 0.64
63 0.66
64 0.72
65 0.78
66 0.8
67 0.72
68 0.67
69 0.59
70 0.55
71 0.55
72 0.52
73 0.53
74 0.5
75 0.55
76 0.57
77 0.61
78 0.61
79 0.61
80 0.62
81 0.57
82 0.58
83 0.57
84 0.58
85 0.54
86 0.56
87 0.58
88 0.58
89 0.61
90 0.59
91 0.61
92 0.6
93 0.64
94 0.64
95 0.64
96 0.66
97 0.66
98 0.62
99 0.61
100 0.58
101 0.52
102 0.44
103 0.36
104 0.28
105 0.22
106 0.26
107 0.21
108 0.2
109 0.21
110 0.24
111 0.24