Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2XCM3

Protein Details
Accession G2XCM3    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
261-280DKETLRRESHQKRPRWERPFBasic
383-418PSKAKEEKERDDIRKRNMNRIKKRTVPKVDNVYSRRBasic
NLS Segment(s)
PositionSequence
240-292NSNRKRPHDDTRRQDEGGRRQDKETLRRESHQKRPRWERPFEQSPRGRDRRER
389-406EKERDDIRKRNMNRIKKR
Subcellular Location(s) mito 11, plas 4, extr 3, nucl 2, pero 2, E.R. 2, golg 2
Family & Domain DBs
KEGG vda:VDAG_07905  -  
Amino Acid Sequences MVRRRLLLRTGDRRLRLALLAYLAITVHPVLLVPRHLWDRTHLLRIMGPTVPRHPTLHNPTNHQGTMGTPIVRHRIHTTALLMATTALLTAMTGPPQGSPYARPVSAFREHGVENERDWDQNHAAGFREPPEPRVSDDLRRPLPRPAEFDQLAKPSQAQGAMPVREIPQFDSMRDDPDFRSKGQPSKPQREARLSPKQPGVLAKAASPPPPATPLRKWKTPAEILAGPSPAILKAAEERNSNRKRPHDDTRRQDEGGRRQDKETLRRESHQKRPRWERPFEQSPRGRDRRERSFRDDSAGDIEGRRSRSRDSYHRDSGRPFSPLPADAGTPPPQSRTSSRRSSFASQVGEARQRRSMSRASFVSSGTHESDLSSVGAELLGLPSKAKEEKERDDIRKRNMNRIKKRTVPKVDNVYSRRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.55
3 0.47
4 0.39
5 0.32
6 0.25
7 0.23
8 0.2
9 0.17
10 0.14
11 0.12
12 0.1
13 0.08
14 0.06
15 0.05
16 0.06
17 0.07
18 0.1
19 0.12
20 0.13
21 0.17
22 0.22
23 0.24
24 0.25
25 0.28
26 0.35
27 0.37
28 0.43
29 0.4
30 0.36
31 0.38
32 0.39
33 0.37
34 0.31
35 0.29
36 0.26
37 0.3
38 0.32
39 0.32
40 0.33
41 0.33
42 0.4
43 0.47
44 0.52
45 0.51
46 0.55
47 0.59
48 0.62
49 0.59
50 0.49
51 0.4
52 0.32
53 0.33
54 0.29
55 0.24
56 0.18
57 0.22
58 0.28
59 0.28
60 0.3
61 0.28
62 0.28
63 0.29
64 0.3
65 0.29
66 0.25
67 0.25
68 0.22
69 0.18
70 0.15
71 0.13
72 0.1
73 0.08
74 0.04
75 0.03
76 0.03
77 0.05
78 0.05
79 0.06
80 0.07
81 0.07
82 0.08
83 0.09
84 0.11
85 0.11
86 0.12
87 0.18
88 0.22
89 0.22
90 0.22
91 0.24
92 0.28
93 0.32
94 0.32
95 0.26
96 0.26
97 0.26
98 0.28
99 0.3
100 0.25
101 0.21
102 0.23
103 0.23
104 0.2
105 0.21
106 0.22
107 0.18
108 0.19
109 0.19
110 0.17
111 0.17
112 0.17
113 0.18
114 0.16
115 0.21
116 0.19
117 0.21
118 0.24
119 0.23
120 0.25
121 0.3
122 0.31
123 0.31
124 0.37
125 0.42
126 0.45
127 0.47
128 0.47
129 0.46
130 0.5
131 0.47
132 0.47
133 0.43
134 0.44
135 0.42
136 0.42
137 0.39
138 0.35
139 0.33
140 0.27
141 0.23
142 0.16
143 0.16
144 0.15
145 0.11
146 0.14
147 0.19
148 0.19
149 0.19
150 0.19
151 0.19
152 0.2
153 0.21
154 0.17
155 0.19
156 0.19
157 0.19
158 0.24
159 0.23
160 0.24
161 0.25
162 0.24
163 0.18
164 0.25
165 0.27
166 0.22
167 0.29
168 0.29
169 0.35
170 0.4
171 0.48
172 0.49
173 0.57
174 0.65
175 0.64
176 0.66
177 0.67
178 0.65
179 0.65
180 0.67
181 0.6
182 0.56
183 0.52
184 0.48
185 0.41
186 0.38
187 0.33
188 0.25
189 0.23
190 0.19
191 0.2
192 0.21
193 0.21
194 0.2
195 0.16
196 0.14
197 0.18
198 0.19
199 0.2
200 0.25
201 0.35
202 0.38
203 0.42
204 0.45
205 0.44
206 0.49
207 0.47
208 0.42
209 0.37
210 0.34
211 0.32
212 0.3
213 0.26
214 0.19
215 0.16
216 0.14
217 0.09
218 0.08
219 0.06
220 0.05
221 0.08
222 0.12
223 0.15
224 0.18
225 0.21
226 0.31
227 0.37
228 0.42
229 0.44
230 0.47
231 0.52
232 0.56
233 0.64
234 0.65
235 0.69
236 0.73
237 0.76
238 0.74
239 0.67
240 0.64
241 0.61
242 0.6
243 0.6
244 0.57
245 0.5
246 0.46
247 0.52
248 0.54
249 0.55
250 0.53
251 0.52
252 0.5
253 0.53
254 0.62
255 0.64
256 0.68
257 0.68
258 0.67
259 0.68
260 0.75
261 0.81
262 0.79
263 0.77
264 0.74
265 0.74
266 0.78
267 0.74
268 0.73
269 0.68
270 0.67
271 0.71
272 0.7
273 0.66
274 0.64
275 0.67
276 0.68
277 0.72
278 0.72
279 0.7
280 0.71
281 0.68
282 0.64
283 0.56
284 0.46
285 0.4
286 0.35
287 0.27
288 0.19
289 0.21
290 0.2
291 0.23
292 0.24
293 0.22
294 0.24
295 0.31
296 0.38
297 0.45
298 0.5
299 0.55
300 0.63
301 0.67
302 0.66
303 0.63
304 0.62
305 0.55
306 0.5
307 0.42
308 0.35
309 0.32
310 0.3
311 0.28
312 0.24
313 0.22
314 0.19
315 0.23
316 0.24
317 0.25
318 0.24
319 0.25
320 0.26
321 0.29
322 0.34
323 0.37
324 0.4
325 0.47
326 0.49
327 0.51
328 0.55
329 0.56
330 0.56
331 0.55
332 0.51
333 0.42
334 0.44
335 0.43
336 0.46
337 0.43
338 0.4
339 0.39
340 0.38
341 0.38
342 0.39
343 0.42
344 0.38
345 0.43
346 0.42
347 0.41
348 0.4
349 0.39
350 0.37
351 0.31
352 0.3
353 0.25
354 0.24
355 0.2
356 0.18
357 0.18
358 0.17
359 0.15
360 0.11
361 0.08
362 0.07
363 0.07
364 0.06
365 0.06
366 0.06
367 0.08
368 0.07
369 0.08
370 0.09
371 0.13
372 0.17
373 0.2
374 0.28
375 0.35
376 0.43
377 0.52
378 0.62
379 0.67
380 0.74
381 0.78
382 0.78
383 0.8
384 0.77
385 0.78
386 0.78
387 0.8
388 0.81
389 0.83
390 0.83
391 0.83
392 0.89
393 0.89
394 0.9
395 0.87
396 0.86
397 0.86
398 0.84
399 0.84